Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SAK_RS03275 | Genome accession | NC_007432 |
| Coordinates | 585900..586079 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae A909 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 547064..586079 | 585900..586079 | within | 0 |
Gene organization within MGE regions
Location: 547064..586079
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAK_RS03010 (SAK_0604) | - | 547082..547921 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| SAK_RS03015 (SAK_0605) | - | 547896..548498 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| SAK_RS03020 (SAK_0606) | - | 548601..548876 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| SAK_RS03025 (SAK_0607) | - | 548964..550106 (-) | 1143 | WP_000269476.1 | tyrosine-type recombinase/integrase | - |
| SAK_RS03030 (SAK_0608) | - | 550234..550443 (-) | 210 | WP_000442169.1 | TM2 domain-containing protein | - |
| SAK_RS03035 (SAK_0609) | - | 550495..550875 (-) | 381 | WP_000700104.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SAK_RS03040 (SAK_0610) | - | 550862..551221 (-) | 360 | WP_000555955.1 | helix-turn-helix domain-containing protein | - |
| SAK_RS03045 (SAK_0611) | - | 551413..551631 (+) | 219 | WP_000257547.1 | helix-turn-helix domain-containing protein | - |
| SAK_RS11600 | - | 551640..551717 (+) | 78 | Protein_523 | phage antirepressor Ant | - |
| SAK_RS03050 (SAK_0612) | - | 551729..552061 (+) | 333 | WP_000158652.1 | hypothetical protein | - |
| SAK_RS03055 (SAK_0613) | - | 552166..552501 (-) | 336 | WP_000360288.1 | hypothetical protein | - |
| SAK_RS03060 | - | 552647..552832 (+) | 186 | WP_000263692.1 | helix-turn-helix domain-containing protein | - |
| SAK_RS03065 | - | 552911..553222 (+) | 312 | WP_001123481.1 | hypothetical protein | - |
| SAK_RS11525 (SAK_0614) | - | 553227..553376 (+) | 150 | WP_000732607.1 | hypothetical protein | - |
| SAK_RS03070 | - | 553452..553652 (+) | 201 | WP_001058282.1 | hypothetical protein | - |
| SAK_RS03075 (SAK_0615) | - | 553649..553939 (+) | 291 | WP_000650504.1 | hypothetical protein | - |
| SAK_RS03080 (SAK_0616) | - | 553926..554609 (+) | 684 | WP_000704949.1 | AAA family ATPase | - |
| SAK_RS03085 (SAK_0617) | - | 554615..556048 (+) | 1434 | Protein_532 | DEAD/DEAH box helicase | - |
| SAK_RS03090 (SAK_0618) | - | 556053..556535 (+) | 483 | WP_000896928.1 | DUF669 domain-containing protein | - |
| SAK_RS03095 (SAK_0619) | - | 556553..558106 (+) | 1554 | WP_000203210.1 | hypothetical protein | - |
| SAK_RS03100 (SAK_0620) | - | 558375..559244 (+) | 870 | WP_000274892.1 | bifunctional DNA primase/polymerase | - |
| SAK_RS03105 (SAK_0621) | - | 559264..559545 (+) | 282 | WP_001866078.1 | VRR-NUC domain-containing protein | - |
| SAK_RS03110 (SAK_0622) | - | 559624..559920 (+) | 297 | WP_000763908.1 | nucleotide modification associated domain-containing protein | - |
| SAK_RS03115 | - | 559904..560143 (+) | 240 | WP_000150115.1 | hypothetical protein | - |
| SAK_RS10920 (SAK_0623) | - | 560174..560338 (+) | 165 | WP_000159368.1 | hypothetical protein | - |
| SAK_RS03120 | - | 560335..560604 (+) | 270 | WP_000139628.1 | hypothetical protein | - |
| SAK_RS11530 (SAK_0624) | - | 560608..560751 (+) | 144 | WP_000564605.1 | hypothetical protein | - |
| SAK_RS03125 (SAK_0625) | - | 560748..561260 (+) | 513 | WP_001019149.1 | DUF1642 domain-containing protein | - |
| SAK_RS03130 (SAK_0626) | - | 561281..561580 (+) | 300 | WP_001105090.1 | hypothetical protein | - |
| SAK_RS03135 (SAK_0627) | - | 561768..561962 (+) | 195 | WP_000221696.1 | hypothetical protein | - |
| SAK_RS03140 (SAK_0628) | - | 561959..562225 (+) | 267 | WP_000660741.1 | hypothetical protein | - |
| SAK_RS03145 (SAK_0629) | - | 562616..563041 (+) | 426 | WP_000533370.1 | DUF1492 domain-containing protein | - |
| SAK_RS10930 (SAK_0630) | - | 563610..563987 (+) | 378 | WP_017646473.1 | HNH endonuclease | - |
| SAK_RS03155 (SAK_0631) | - | 564138..564494 (+) | 357 | WP_000725958.1 | hypothetical protein | - |
| SAK_RS03160 (SAK_0632) | - | 564491..565759 (+) | 1269 | WP_001108673.1 | phage portal protein | - |
| SAK_RS03165 (SAK_0633) | - | 565752..566972 (+) | 1221 | WP_000227335.1 | polymorphic toxin type 50 domain-containing protein | - |
| SAK_RS03170 (SAK_0634) | - | 566972..567160 (+) | 189 | WP_000421991.1 | hypothetical protein | - |
| SAK_RS03175 (SAK_0635) | - | 567268..568683 (+) | 1416 | WP_000256854.1 | terminase large subunit | - |
| SAK_RS03180 (SAK_0636) | - | 568764..569228 (+) | 465 | WP_001288696.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| SAK_RS03185 (SAK_0637) | - | 569231..570133 (+) | 903 | WP_000841024.1 | phage major capsid protein | - |
| SAK_RS03190 (SAK_0638) | - | 570130..570345 (+) | 216 | WP_000640308.1 | hypothetical protein | - |
| SAK_RS03195 (SAK_0639) | - | 570359..570790 (+) | 432 | WP_000180799.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SAK_RS03200 (SAK_0640) | - | 570741..571079 (+) | 339 | WP_001096306.1 | hypothetical protein | - |
| SAK_RS03205 | - | 571072..571308 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| SAK_RS03210 (SAK_0641) | - | 571309..571644 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| SAK_RS03215 (SAK_0642) | - | 571654..572211 (+) | 558 | WP_000226353.1 | tail protein | - |
| SAK_RS03220 (SAK_0643) | - | 572211..572456 (+) | 246 | WP_000858406.1 | hypothetical protein | - |
| SAK_RS03225 (SAK_0644) | - | 572471..572842 (+) | 372 | WP_000916438.1 | DUF5361 domain-containing protein | - |
| SAK_RS03230 (SAK_0645) | - | 572842..574854 (+) | 2013 | WP_000224696.1 | phage tail protein | - |
| SAK_RS03235 (SAK_0646) | - | 574848..576380 (+) | 1533 | WP_000228808.1 | distal tail protein Dit | - |
| SAK_RS03240 (SAK_0647) | - | 576381..580502 (+) | 4122 | WP_000955545.1 | glucosaminidase domain-containing protein | - |
| SAK_RS03245 (SAK_0648) | - | 580503..582506 (+) | 2004 | WP_000206874.1 | DUF859 family phage minor structural protein | - |
| SAK_RS03250 (SAK_0649) | - | 582518..582910 (+) | 393 | WP_000889198.1 | DUF1366 domain-containing protein | - |
| SAK_RS11765 (SAK_0650) | - | 582933..583061 (+) | 129 | WP_000973385.1 | hypothetical protein | - |
| SAK_RS03260 (SAK_0651) | - | 583070..583372 (+) | 303 | WP_001017826.1 | hypothetical protein | - |
| SAK_RS03265 (SAK_0652) | - | 583365..583592 (+) | 228 | WP_000609111.1 | phage holin | - |
| SAK_RS03270 (SAK_0653) | - | 583718..585049 (+) | 1332 | WP_000257237.1 | GH25 family lysozyme | - |
| SAK_RS10935 (SAK_0654) | - | 585311..585481 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| SAK_RS11770 | - | 585617..585742 (-) | 126 | WP_017285425.1 | hypothetical protein | - |
| SAK_RS03275 (SAK_0655) | prx | 585900..586079 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=24737 SAK_RS03275 WP_000965651.1 585900..586079(+) (prx) [Streptococcus agalactiae A909]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=24737 SAK_RS03275 WP_000965651.1 585900..586079(+) (prx) [Streptococcus agalactiae A909]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |