Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | M5005_RS07015 | Genome accession | NC_007297 |
| Coordinates | 1385380..1385559 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes MGAS5005 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1385380..1425996 | 1385380..1385559 | within | 0 |
Gene organization within MGE regions
Location: 1385380..1425996
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5005_RS07015 (M5005_Spy1414) | prx | 1385380..1385559 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| M5005_RS07020 (M5005_Spy1415) | sda1 | 1385798..1386970 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| M5005_RS07025 (M5005_Spy1416) | - | 1387086..1388282 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| M5005_RS07035 (M5005_Spy1417) | - | 1388393..1388578 (-) | 186 | WP_002988802.1 | holin | - |
| M5005_RS07040 (M5005_Spy1418) | - | 1388575..1388874 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| M5005_RS07045 (M5005_Spy1419) | - | 1388885..1389505 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| M5005_RS09950 (M5005_Spy1420) | - | 1389508..1389669 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| M5005_RS07050 (M5005_Spy1421) | - | 1389678..1391585 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| M5005_RS07055 (M5005_Spy1422) | - | 1391596..1392231 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| M5005_RS07060 (M5005_Spy1423) | - | 1392231..1393286 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| M5005_RS07065 (M5005_Spy1424) | - | 1393283..1395265 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| M5005_RS07070 (M5005_Spy1425) | - | 1395275..1396117 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| M5005_RS07075 (M5005_Spy1426) | - | 1396129..1400511 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| M5005_RS07080 (M5005_Spy1427) | - | 1400526..1400759 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| M5005_RS07085 (M5005_Spy1428) | - | 1400834..1401289 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| M5005_RS07090 (M5005_Spy1429) | - | 1401343..1401942 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| M5005_RS07095 (M5005_Spy1430) | - | 1401954..1402313 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| M5005_RS07100 (M5005_Spy1431) | - | 1402317..1402661 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M5005_RS07105 (M5005_Spy1432) | - | 1402658..1402936 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| M5005_RS07110 (M5005_Spy1433) | - | 1402947..1403303 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| M5005_RS07115 (M5005_Spy1434) | - | 1403315..1404202 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| M5005_RS07120 (M5005_Spy1435) | - | 1404215..1404784 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| M5005_RS07125 (M5005_Spy1436) | - | 1404940..1405206 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| M5005_RS07130 (M5005_Spy1437) | - | 1405209..1405397 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| M5005_RS07135 (M5005_Spy1438) | - | 1405428..1406873 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| M5005_RS07140 (M5005_Spy1439) | - | 1406833..1408365 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| M5005_RS07145 (M5005_Spy1440) | - | 1408381..1409658 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| M5005_RS07150 (M5005_Spy1441) | - | 1409648..1410100 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| M5005_RS07155 (M5005_Spy1442) | - | 1410190..1410606 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| M5005_RS07160 (M5005_Spy1443) | - | 1410603..1410794 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| M5005_RS07165 (M5005_Spy1444) | - | 1410784..1411635 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| M5005_RS07170 (M5005_Spy1445) | - | 1411644..1411910 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| M5005_RS09955 (M5005_Spy1446) | - | 1411907..1412074 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| M5005_RS07175 (M5005_Spy1447) | - | 1412075..1413397 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| M5005_RS07180 (M5005_Spy1448) | - | 1413394..1413669 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| M5005_RS07185 (M5005_Spy1449) | - | 1414056..1416440 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| M5005_RS07190 (M5005_Spy1450) | - | 1416445..1418367 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| M5005_RS07195 (M5005_Spy1451) | - | 1418410..1418967 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| M5005_RS07200 (M5005_Spy1452) | - | 1418978..1419376 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| M5005_RS07205 (M5005_Spy1453) | - | 1419380..1420534 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| M5005_RS07210 (M5005_Spy1454) | - | 1420534..1420833 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| M5005_RS07215 (M5005_Spy1455) | - | 1420921..1421124 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| M5005_RS07220 (M5005_Spy1457) | - | 1421270..1421656 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| M5005_RS07225 (M5005_Spy1458) | - | 1421653..1421856 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| M5005_RS09960 (M5005_Spy1459) | - | 1421849..1422019 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| M5005_RS07230 (M5005_Spy1460) | - | 1422016..1422291 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| M5005_RS07235 (M5005_Spy1461) | - | 1422353..1422568 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| M5005_RS07240 (M5005_Spy1462) | - | 1422616..1423029 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| M5005_RS09965 (M5005_Spy1463) | - | 1423010..1423165 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| M5005_RS07245 (M5005_Spy1464) | - | 1423491..1423841 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| M5005_RS07250 (M5005_Spy1465) | - | 1423855..1424238 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M5005_RS07255 (M5005_Spy1466) | - | 1424249..1424800 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| M5005_RS07260 (M5005_Spy1467) | - | 1424917..1425996 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=24557 M5005_RS07015 WP_002988813.1 1385380..1385559(-) (prx) [Streptococcus pyogenes MGAS5005]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=24557 M5005_RS07015 WP_002988813.1 1385380..1385559(-) (prx) [Streptococcus pyogenes MGAS5005]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |