Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M5005_RS05775 | Genome accession | NC_007297 |
| Coordinates | 1145702..1145884 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS5005 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1145702..1179188 | 1145702..1145884 | within | 0 |
Gene organization within MGE regions
Location: 1145702..1179188
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5005_RS05775 (M5005_Spy1168) | prx | 1145702..1145884 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| M5005_RS05780 (M5005_Spy1169) | sda3 | 1146123..1146923 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| M5005_RS05785 (M5005_Spy1170) | - | 1147194..1147628 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| M5005_RS05790 (M5005_Spy1171) | - | 1147698..1148903 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| M5005_RS05800 (M5005_Spy1172) | - | 1149019..1149246 (-) | 228 | WP_003058873.1 | phage holin | - |
| M5005_RS05805 (M5005_Spy1173) | - | 1149243..1149518 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| M5005_RS05810 (M5005_Spy1174) | - | 1149528..1150145 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| M5005_RS05815 (M5005_Spy1175) | - | 1150142..1150579 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| M5005_RS05820 (M5005_Spy1176) | - | 1150591..1152459 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| M5005_RS05825 (M5005_Spy1177) | - | 1152456..1153151 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| M5005_RS05830 (M5005_Spy1178) | - | 1153148..1155505 (-) | 2358 | WP_010922453.1 | phage tail protein | - |
| M5005_RS05835 (M5005_Spy1179) | - | 1155505..1155876 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| M5005_RS05840 (M5005_Spy1180) | - | 1155891..1156154 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| M5005_RS05845 (M5005_Spy1181) | - | 1156165..1156758 (-) | 594 | WP_010922456.1 | tail protein | - |
| M5005_RS05850 (M5005_Spy1182) | - | 1156770..1157105 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| M5005_RS05855 (M5005_Spy1183) | - | 1157106..1157342 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| M5005_RS05860 (M5005_Spy1184) | - | 1157335..1157673 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| M5005_RS05865 (M5005_Spy1185) | - | 1157633..1158055 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| M5005_RS05870 (M5005_Spy1186) | - | 1158065..1158265 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| M5005_RS05875 (M5005_Spy1187) | - | 1158265..1159176 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| M5005_RS05880 (M5005_Spy1188) | - | 1159201..1159662 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| M5005_RS05885 (M5005_Spy1189) | - | 1159743..1161158 (-) | 1416 | WP_011285619.1 | terminase | - |
| M5005_RS05890 (M5005_Spy1190) | - | 1161268..1161534 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| M5005_RS05895 (M5005_Spy1191) | - | 1161527..1161706 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| M5005_RS05900 (M5005_Spy1192) | - | 1161756..1161980 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| M5005_RS05905 (M5005_Spy1193) | - | 1161986..1163479 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| M5005_RS05910 (M5005_Spy1194) | - | 1163472..1164740 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| M5005_RS05915 (M5005_Spy1195) | - | 1164737..1165093 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| M5005_RS05920 (M5005_Spy1196) | - | 1165242..1165586 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| M5005_RS05925 (M5005_Spy1197) | - | 1165695..1166114 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| M5005_RS05930 (M5005_Spy1198) | - | 1166382..1167017 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| M5005_RS05935 (M5005_Spy1199) | - | 1167019..1167288 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| M5005_RS05940 (M5005_Spy1200) | - | 1167372..1167884 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| M5005_RS05945 (M5005_Spy1201) | - | 1167881..1168222 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| M5005_RS09930 (M5005_Spy1202) | - | 1168400..1168567 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| M5005_RS05950 (M5005_Spy1203) | - | 1168577..1169374 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| M5005_RS05955 (M5005_Spy1204) | - | 1169371..1170300 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| M5005_RS05960 (M5005_Spy1205) | - | 1170303..1170632 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| M5005_RS05965 (M5005_Spy1206) | - | 1170688..1170894 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| M5005_RS09935 (M5005_Spy1207) | - | 1170903..1171043 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| M5005_RS05970 (M5005_Spy1208) | - | 1171040..1171273 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| M5005_RS05975 (M5005_Spy1209) | - | 1171254..1171643 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| M5005_RS10085 (M5005_Spy1210) | - | 1171788..1172027 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| M5005_RS05985 (M5005_Spy1211) | - | 1172127..1172312 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| M5005_RS05990 (M5005_Spy1212) | - | 1172314..1172625 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| M5005_RS05995 (M5005_Spy1213) | - | 1172703..1172888 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| M5005_RS06000 (M5005_Spy1214) | - | 1173055..1173294 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| M5005_RS06005 (M5005_Spy1215) | - | 1173436..1174242 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| M5005_RS09520 (M5005_Spy1216) | - | 1174177..1174443 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| M5005_RS06010 (M5005_Spy1217) | - | 1174475..1175191 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| M5005_RS06015 (M5005_Spy1218) | - | 1175203..1175394 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| M5005_RS09525 | - | 1176030..1176125 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| M5005_RS06020 (M5005_Spy1219) | - | 1176548..1176895 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| M5005_RS06025 (M5005_Spy1220) | - | 1176899..1177279 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M5005_RS06030 (M5005_Spy1221) | - | 1177291..1177557 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| M5005_RS06035 (M5005_Spy1222) | - | 1177681..1178823 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| M5005_RS06040 (M5005_Spy1223) | - | 1178913..1179188 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=24550 M5005_RS05775 WP_011017964.1 1145702..1145884(-) (prx) [Streptococcus pyogenes MGAS5005]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=24550 M5005_RS05775 WP_011017964.1 1145702..1145884(-) (prx) [Streptococcus pyogenes MGAS5005]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |