Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M5005_RS04945 | Genome accession | NC_007297 |
| Coordinates | 983959..984147 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS5005 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 976375..1022685 | 983959..984147 | within | 0 |
Gene organization within MGE regions
Location: 976375..1022685
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5005_RS04915 (M5005_Spy0989) | pfkA | 976375..977388 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| M5005_RS04920 (M5005_Spy0990) | - | 977468..980578 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| M5005_RS04925 (M5005_Spy0991) | - | 980763..981134 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| M5005_RS04930 (M5005_Spy0992) | - | 981134..981832 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| M5005_RS04935 (M5005_Spy0993) | - | 981842..982627 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| M5005_RS04940 (M5005_Spy0994) | - | 982754..983368 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| M5005_RS04945 (M5005_Spy0995) | prx | 983959..984147 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| M5005_RS04950 (M5005_Spy0996) | speA | 984367..985122 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| M5005_RS04955 (M5005_Spy0997) | - | 985244..985903 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| M5005_RS04960 (M5005_Spy0998) | - | 985903..986124 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| M5005_RS04965 (M5005_Spy0999) | - | 986134..986907 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| M5005_RS04970 (M5005_Spy1000) | - | 986918..987520 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| M5005_RS04975 (M5005_Spy1001) | - | 987532..988296 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| M5005_RS04980 (M5005_Spy1002) | - | 988298..988630 (-) | 333 | WP_011285562.1 | phage holin | - |
| M5005_RS04985 (M5005_Spy1003) | - | 988630..988953 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| M5005_RS10160 (M5005_Spy1004) | - | 988967..989089 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| M5005_RS04995 (M5005_Spy1005) | - | 989103..989450 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| M5005_RS05000 (M5005_Spy1006) | - | 989461..991323 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| M5005_RS05005 (M5005_Spy1007) | - | 991328..994768 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| M5005_RS05010 (M5005_Spy1008) | - | 994769..996253 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| M5005_RS05015 (M5005_Spy1009) | - | 996254..998059 (-) | 1806 | WP_011054802.1 | phage tail protein | - |
| M5005_RS05020 (M5005_Spy1010) | - | 998052..998510 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| M5005_RS05025 (M5005_Spy1011) | - | 998483..998800 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| M5005_RS05030 (M5005_Spy1012) | - | 998813..999319 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| M5005_RS05035 (M5005_Spy1013) | - | 999331..999741 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| M5005_RS05040 (M5005_Spy1014) | - | 999743..1000138 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| M5005_RS05045 (M5005_Spy1015) | - | 1000135..1000446 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| M5005_RS05050 (M5005_Spy1016) | - | 1000443..1000787 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| M5005_RS05055 (M5005_Spy1017) | - | 1000801..1001094 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| M5005_RS05060 (M5005_Spy1018) | - | 1001107..1001997 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| M5005_RS05065 (M5005_Spy1019) | - | 1002016..1002585 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| M5005_RS10165 | - | 1002694..1002828 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| M5005_RS05070 (M5005_Spy1020) | - | 1002830..1003099 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| M5005_RS05075 (M5005_Spy1021) | - | 1003106..1004014 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| M5005_RS05080 (M5005_Spy1022) | - | 1003983..1005308 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| M5005_RS05085 (M5005_Spy1023) | - | 1005308..1006582 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| M5005_RS05090 (M5005_Spy1024) | - | 1006572..1006952 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| M5005_RS05095 (M5005_Spy1025) | - | 1007562..1007996 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M5005_RS05100 (M5005_Spy1026) | - | 1008282..1008548 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| M5005_RS05105 (M5005_Spy1027) | - | 1008545..1009069 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| M5005_RS05110 (M5005_Spy1028) | - | 1009072..1009704 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| M5005_RS05115 (M5005_Spy1029) | - | 1009706..1009990 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| M5005_RS09910 (M5005_Spy1030) | - | 1009987..1010157 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| M5005_RS05120 (M5005_Spy1031) | - | 1010154..1010390 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| M5005_RS10190 (M5005_Spy1032) | - | 1010390..1010635 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| M5005_RS05130 (M5005_Spy1033) | - | 1010632..1010988 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| M5005_RS05135 (M5005_Spy1034) | - | 1010985..1011425 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M5005_RS05140 (M5005_Spy1035) | - | 1011425..1011628 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| M5005_RS05145 (M5005_Spy1036) | ssb | 1011634..1012059 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| M5005_RS05150 (M5005_Spy1037) | - | 1012052..1012726 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| M5005_RS05155 (M5005_Spy1038) | - | 1012727..1013209 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| M5005_RS05160 (M5005_Spy1039) | - | 1013231..1013485 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| M5005_RS05165 (M5005_Spy1040) | - | 1013466..1013819 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| M5005_RS05170 (M5005_Spy1042) | - | 1013960..1014742 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| M5005_RS05175 (M5005_Spy1043) | - | 1014729..1015559 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| M5005_RS10070 | - | 1015573..1015761 (-) | 189 | Protein_976 | XRE family transcriptional regulator | - |
| M5005_RS10075 | - | 1015995..1016234 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| M5005_RS05185 | - | 1016365..1016574 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| M5005_RS05190 (M5005_Spy1045) | - | 1016684..1016884 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| M5005_RS05195 (M5005_Spy1046) | - | 1016958..1017344 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| M5005_RS05200 (M5005_Spy1047) | - | 1017333..1017542 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| M5005_RS05205 (M5005_Spy1048) | - | 1017596..1018195 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| M5005_RS09915 (M5005_Spy1049) | - | 1018225..1018383 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| M5005_RS05210 (M5005_Spy1050) | - | 1018740..1019564 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| M5005_RS05215 (M5005_Spy1051) | - | 1019600..1020493 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| M5005_RS05220 (M5005_Spy1052) | - | 1020614..1021702 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| M5005_RS05225 (M5005_Spy1054) | - | 1022065..1022685 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=24546 M5005_RS04945 WP_011285559.1 983959..984147(-) (prx) [Streptococcus pyogenes MGAS5005]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=24546 M5005_RS04945 WP_011285559.1 983959..984147(-) (prx) [Streptococcus pyogenes MGAS5005]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |