Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M28_RS06255 | Genome accession | NC_007296 |
| Coordinates | 1227133..1227315 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes MGAS6180 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1227133..1269163 | 1227133..1227315 | within | 0 |
Gene organization within MGE regions
Location: 1227133..1269163
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M28_RS06255 (M28_Spy1220) | prx | 1227133..1227315 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| M28_RS06265 (M28_Spy1222) | - | 1227661..1228236 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| M28_RS06270 (M28_Spy1223) | spek | 1228712..1229491 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| M28_RS06275 (M28_Spy1224) | - | 1229795..1230661 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| M28_RS06280 (M28_Spy1225) | - | 1230649..1231173 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| M28_RS06285 (M28_Spy1226) | - | 1231313..1232515 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| M28_RS06290 (M28_Spy1227) | - | 1232626..1232811 (-) | 186 | WP_011054731.1 | holin | - |
| M28_RS06295 (M28_Spy1228) | - | 1232808..1233104 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| M28_RS06300 (M28_Spy1229) | - | 1233115..1233726 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| M28_RS06305 (M28_Spy1230) | - | 1233729..1234160 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| M28_RS06310 (M28_Spy1231) | - | 1234172..1236058 (-) | 1887 | WP_011284969.1 | gp58-like family protein | - |
| M28_RS06315 (M28_Spy1232) | - | 1236069..1236383 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| M28_RS06320 (M28_Spy1233) | - | 1236385..1237599 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| M28_RS06325 (M28_Spy1234) | - | 1237596..1239743 (-) | 2148 | WP_011284971.1 | phage tail spike protein | - |
| M28_RS06330 (M28_Spy1235) | - | 1239740..1240456 (-) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| M28_RS06335 (M28_Spy1236) | - | 1240453..1243713 (-) | 3261 | WP_044564888.1 | tape measure protein | - |
| M28_RS06340 (M28_Spy1237) | - | 1243703..1244284 (-) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| M28_RS06345 (M28_Spy1238) | - | 1244288..1244722 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| M28_RS06350 (M28_Spy1239) | - | 1244761..1245246 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| M28_RS06355 (M28_Spy1240) | - | 1245246..1245644 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| M28_RS06360 (M28_Spy1241) | - | 1245641..1245997 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| M28_RS06365 (M28_Spy1242) | - | 1245997..1246329 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| M28_RS06370 (M28_Spy1243) | - | 1246319..1246735 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| M28_RS06375 (M28_Spy1244) | - | 1246789..1247607 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| M28_RS06380 (M28_Spy1245) | - | 1247611..1248225 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| M28_RS06385 (M28_Spy1246) | - | 1248351..1248617 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| M28_RS06390 (M28_Spy1247) | - | 1248679..1248918 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| M28_RS06395 (M28_Spy1248) | - | 1248890..1250368 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| M28_RS06400 (M28_Spy1249) | - | 1250373..1251875 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| M28_RS06405 (M28_Spy1250) | - | 1251889..1253180 (-) | 1292 | Protein_1200 | PBSX family phage terminase large subunit | - |
| M28_RS06410 (M28_Spy1251) | - | 1253183..1253656 (-) | 474 | WP_023612332.1 | hypothetical protein | - |
| M28_RS06415 (M28_Spy1252) | - | 1253707..1254084 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| M28_RS06420 (M28_Spy1253) | - | 1254145..1254621 (-) | 477 | WP_174132581.1 | GNAT family N-acetyltransferase | - |
| M28_RS06425 (M28_Spy1254) | - | 1254537..1255214 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| M28_RS06430 (M28_Spy1255) | - | 1255193..1255711 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| M28_RS06435 (M28_Spy1256) | - | 1255792..1256049 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| M28_RS06455 (M28_Spy1258) | - | 1256688..1257128 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M28_RS09805 | - | 1257402..1257572 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| M28_RS06460 (M28_Spy1259) | - | 1257569..1258075 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| M28_RS09810 (M28_Spy1260) | - | 1258072..1258242 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| M28_RS06465 (M28_Spy1261) | - | 1258239..1258643 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| M28_RS06470 (M28_Spy1262) | - | 1258653..1258922 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| M28_RS06475 (M28_Spy1263) | - | 1258919..1259203 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| M28_RS06480 (M28_Spy1264) | - | 1259197..1259448 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| M28_RS06485 (M28_Spy1265) | - | 1259445..1259801 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| M28_RS06490 (M28_Spy1266) | - | 1259798..1260238 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M28_RS06495 (M28_Spy1267) | - | 1260238..1260441 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| M28_RS06500 (M28_Spy1268) | ssbA | 1260447..1260866 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| M28_RS06505 (M28_Spy1269) | - | 1260859..1261533 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| M28_RS06510 (M28_Spy1270) | - | 1261534..1262016 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| M28_RS06515 (M28_Spy1271) | - | 1262038..1262292 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| M28_RS06520 (M28_Spy1272) | - | 1262303..1262443 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| M28_RS06525 (M28_Spy1273) | - | 1262440..1262673 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| M28_RS06530 (M28_Spy1274) | - | 1262654..1263067 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| M28_RS06535 (M28_Spy1275) | - | 1263189..1263446 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| M28_RS06540 (M28_Spy1276) | - | 1263540..1263725 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| M28_RS06545 (M28_Spy1277) | - | 1263754..1264011 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| M28_RS06555 (M28_Spy1278) | - | 1264257..1264424 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| M28_RS06560 | - | 1264500..1264700 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| M28_RS09815 (M28_Spy1279) | - | 1264697..1264846 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| M28_RS06565 (M28_Spy1280) | - | 1264879..1265607 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| M28_RS06570 (M28_Spy1281) | - | 1265618..1265809 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| M28_RS06575 (M28_Spy1282) | - | 1266605..1266964 (+) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| M28_RS06580 (M28_Spy1283) | - | 1266978..1267358 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M28_RS06585 (M28_Spy1284) | - | 1267369..1267890 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| M28_RS06590 (M28_Spy1285) | - | 1268066..1269163 (+) | 1098 | WP_015967409.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=24495 M28_RS06255 WP_011054726.1 1227133..1227315(-) (prx) [Streptococcus pyogenes MGAS6180]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=24495 M28_RS06255 WP_011054726.1 1227133..1227315(-) (prx) [Streptococcus pyogenes MGAS6180]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |