Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M28_RS05005 | Genome accession | NC_007296 |
| Coordinates | 986414..986602 (-) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS6180 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 978830..1033356 | 986414..986602 | within | 0 |
Gene organization within MGE regions
Location: 978830..1033356
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M28_RS04970 (M28_Spy0961) | pfkA | 978830..979843 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| M28_RS04975 (M28_Spy0962) | - | 979923..983033 (-) | 3111 | WP_011284836.1 | DNA polymerase III subunit alpha | - |
| M28_RS04980 (M28_Spy0963) | - | 983218..983589 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| M28_RS04985 (M28_Spy0964) | - | 983589..984287 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| M28_RS04990 (M28_Spy0965) | - | 984297..985082 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| M28_RS04995 (M28_Spy0966) | - | 985209..985823 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| M28_RS05005 (M28_Spy0967) | prx | 986414..986602 (-) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| M28_RS05010 (M28_Spy0968) | mf2 | 986842..987600 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| M28_RS05015 (M28_Spy0969) | speC | 987711..988418 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| M28_RS05020 (M28_Spy0970) | - | 988494..989828 (-) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| M28_RS05025 (M28_Spy0971) | - | 989940..990125 (-) | 186 | WP_011284839.1 | holin | - |
| M28_RS05030 (M28_Spy0972) | - | 990122..990418 (-) | 297 | WP_002990012.1 | hypothetical protein | - |
| M28_RS05035 (M28_Spy0973) | - | 990429..991046 (-) | 618 | WP_011284840.1 | hypothetical protein | - |
| M28_RS05040 (M28_Spy0974) | - | 991049..991210 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| M28_RS05045 (M28_Spy0975) | - | 991224..993119 (-) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| M28_RS05050 (M28_Spy0976) | - | 993130..993444 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| M28_RS05055 (M28_Spy0977) | - | 993446..994660 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| M28_RS05060 (M28_Spy0978) | - | 994657..996711 (-) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| M28_RS05065 (M28_Spy0979) | - | 996708..997487 (-) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| M28_RS05070 (M28_Spy0980) | - | 997519..1001154 (-) | 3636 | WP_011284846.1 | tape measure protein | - |
| M28_RS05075 (M28_Spy0981) | - | 1001169..1001465 (-) | 297 | WP_021340179.1 | hypothetical protein | - |
| M28_RS05080 (M28_Spy0982) | - | 1001540..1001893 (-) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| M28_RS05085 (M28_Spy0983) | - | 1001947..1002570 (-) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| M28_RS05090 (M28_Spy0984) | - | 1002625..1003014 (-) | 390 | WP_011284850.1 | hypothetical protein | - |
| M28_RS05095 (M28_Spy0985) | - | 1003011..1003376 (-) | 366 | WP_011284851.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M28_RS05100 (M28_Spy0986) | - | 1003357..1003665 (-) | 309 | WP_011284852.1 | hypothetical protein | - |
| M28_RS05105 (M28_Spy0987) | - | 1003662..1004015 (-) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| M28_RS05110 (M28_Spy0988) | - | 1004029..1004271 (-) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| M28_RS05115 (M28_Spy0989) | - | 1004281..1005363 (-) | 1083 | WP_011284855.1 | major capsid protein | - |
| M28_RS05120 (M28_Spy0990) | - | 1005366..1005746 (-) | 381 | WP_011284856.1 | head decoration protein | - |
| M28_RS05125 (M28_Spy0991) | - | 1005756..1006289 (-) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| M28_RS05130 (M28_Spy0992) | - | 1006433..1006699 (-) | 267 | WP_011284858.1 | hypothetical protein | - |
| M28_RS05135 (M28_Spy0993) | - | 1006702..1007016 (-) | 315 | WP_011284859.1 | hypothetical protein | - |
| M28_RS05140 (M28_Spy0994) | - | 1007086..1007271 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| M28_RS05145 (M28_Spy0995) | - | 1007275..1008837 (-) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| M28_RS05150 (M28_Spy0996) | - | 1008818..1010320 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| M28_RS05155 (M28_Spy0997) | - | 1010332..1011639 (-) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| M28_RS05160 (M28_Spy0998) | - | 1011617..1012048 (-) | 432 | WP_023079766.1 | terminase small subunit | - |
| M28_RS05165 | - | 1012147..1012332 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| M28_RS05170 (M28_Spy0999) | - | 1012384..1012761 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| M28_RS09780 | - | 1013056..1013289 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| M28_RS05180 (M28_Spy1000) | - | 1013379..1014293 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| M28_RS05190 (M28_Spy1002) | - | 1014871..1015305 (-) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M28_RS09785 | - | 1015587..1015757 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| M28_RS05195 (M28_Spy1003) | - | 1015754..1016233 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| M28_RS05200 (M28_Spy1004) | - | 1016238..1016870 (-) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| M28_RS05205 (M28_Spy1005) | - | 1016872..1017156 (-) | 285 | WP_011284869.1 | hypothetical protein | - |
| M28_RS09790 (M28_Spy1006) | - | 1017153..1017323 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| M28_RS05210 (M28_Spy1007) | - | 1017320..1017556 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| M28_RS10010 (M28_Spy1008) | - | 1017556..1017801 (-) | 246 | WP_011284872.1 | hypothetical protein | - |
| M28_RS05220 (M28_Spy1009) | - | 1017798..1018154 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| M28_RS05225 (M28_Spy1010) | - | 1018138..1018422 (-) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| M28_RS05230 (M28_Spy1011) | - | 1018442..1019311 (-) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| M28_RS05235 (M28_Spy1012) | - | 1019580..1021133 (-) | 1554 | WP_011284875.1 | hypothetical protein | - |
| M28_RS05240 (M28_Spy1013) | - | 1021151..1021633 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| M28_RS05245 (M28_Spy1014) | - | 1021638..1023071 (-) | 1434 | Protein_970 | DEAD/DEAH box helicase | - |
| M28_RS05250 (M28_Spy1015) | - | 1023077..1023760 (-) | 684 | WP_002984321.1 | AAA family ATPase | - |
| M28_RS05255 (M28_Spy1016) | - | 1023757..1024041 (-) | 285 | WP_011284877.1 | hypothetical protein | - |
| M28_RS05260 (M28_Spy1017) | - | 1024038..1024232 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| M28_RS05265 (M28_Spy1018) | - | 1024232..1024561 (-) | 330 | WP_011284878.1 | hypothetical protein | - |
| M28_RS05270 (M28_Spy1019) | - | 1024642..1024779 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| M28_RS05275 (M28_Spy1020) | - | 1024776..1025072 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| M28_RS05280 (M28_Spy1021) | - | 1025151..1025336 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| M28_RS05285 (M28_Spy1022) | - | 1025503..1025742 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| M28_RS05290 (M28_Spy1023) | - | 1025892..1026101 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| M28_RS05300 (M28_Spy1024) | - | 1026360..1026869 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| M28_RS05305 (M28_Spy1026) | - | 1026977..1027204 (-) | 228 | WP_002984281.1 | hypothetical protein | - |
| M28_RS05310 (M28_Spy1025) | - | 1027278..1027664 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| M28_RS05315 (M28_Spy1027) | - | 1027653..1027862 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| M28_RS05320 (M28_Spy1028) | - | 1027916..1028515 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| M28_RS05325 (M28_Spy1029) | - | 1028545..1028703 (-) | 159 | WP_011284883.1 | hypothetical protein | - |
| M28_RS05330 | - | 1028762..1028977 (+) | 216 | WP_021341080.1 | hypothetical protein | - |
| M28_RS05335 (M28_Spy1030) | - | 1029470..1030213 (+) | 744 | WP_011284884.1 | XRE family transcriptional regulator | - |
| M28_RS05340 (M28_Spy1031) | - | 1030226..1031035 (+) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M28_RS05345 (M28_Spy1033) | - | 1031285..1032373 (+) | 1089 | WP_023079773.1 | site-specific integrase | - |
| M28_RS05350 (M28_Spy1035) | - | 1032736..1033356 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=24490 M28_RS05005 WP_002993136.1 986414..986602(-) (prx) [Streptococcus pyogenes MGAS6180]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=24490 M28_RS05005 WP_002993136.1 986414..986602(-) (prx) [Streptococcus pyogenes MGAS6180]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |