Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CHF17_RS03505 | Genome accession | NZ_CP022537 |
| Coordinates | 614935..615123 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain 874391 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 606149..614893 | 614935..615123 | flank | 42 |
| IS/Tn | 613868..614479 | 614935..615123 | flank | 456 |
Gene organization within MGE regions
Location: 606149..615123
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CHF17_RS03465 | - | 607528..607689 (-) | 162 | WP_000508795.1 | NINE protein | - |
| CHF17_RS03470 (CHF17_00689) | - | 608431..609708 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| CHF17_RS03475 (CHF17_00690) | - | 609718..610374 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| CHF17_RS03480 (CHF17_00691) | - | 610374..611750 (+) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| CHF17_RS03485 (CHF17_00692) | - | 611847..612500 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| CHF17_RS03490 (CHF17_00693) | - | 612497..613816 (+) | 1320 | WP_000734167.1 | HAMP domain-containing sensor histidine kinase | - |
| CHF17_RS03495 (CHF17_00694) | - | 613868..614515 (-) | 648 | Protein_595 | IS3 family transposase | - |
| CHF17_RS03500 (CHF17_00695) | - | 614693..614893 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| CHF17_RS03505 | prx | 614935..615123 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=240496 CHF17_RS03505 WP_000027835.1 614935..615123(+) (prx) [Streptococcus agalactiae strain 874391]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=240496 CHF17_RS03505 WP_000027835.1 614935..615123(+) (prx) [Streptococcus agalactiae strain 874391]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |