Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CHF17_RS01015 | Genome accession | NZ_CP022537 |
| Coordinates | 144623..144805 (+) | Length | 60 a.a. |
| NCBI ID | WP_000965649.1 | Uniprot ID | A0AAV3JNR0 |
| Organism | Streptococcus agalactiae strain 874391 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 102580..144805 | 144623..144805 | within | 0 |
Gene organization within MGE regions
Location: 102580..144805
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CHF17_RS00725 (CHF17_00141) | - | 102580..103677 (-) | 1098 | WP_000570847.1 | site-specific integrase | - |
| CHF17_RS00730 (CHF17_00142) | - | 103850..104464 (-) | 615 | WP_000742866.1 | hypothetical protein | - |
| CHF17_RS00740 (CHF17_00143) | - | 104596..105375 (-) | 780 | WP_000095652.1 | S24 family peptidase | - |
| CHF17_RS00745 (CHF17_00144) | - | 105736..106029 (+) | 294 | WP_000364978.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CHF17_RS11295 (CHF17_00145) | - | 106013..106183 (-) | 171 | WP_001097075.1 | hypothetical protein | - |
| CHF17_RS00750 (CHF17_00146) | - | 106241..106399 (+) | 159 | WP_001104157.1 | hypothetical protein | - |
| CHF17_RS00755 (CHF17_00147) | - | 106430..106672 (+) | 243 | WP_000219235.1 | hypothetical protein | - |
| CHF17_RS00760 (CHF17_00148) | - | 106658..107215 (-) | 558 | WP_000880594.1 | hypothetical protein | - |
| CHF17_RS00765 (CHF17_00149) | - | 107271..107480 (+) | 210 | WP_001247539.1 | hypothetical protein | - |
| CHF17_RS00770 (CHF17_00150) | - | 107712..107918 (+) | 207 | WP_000164462.1 | helix-turn-helix transcriptional regulator | - |
| CHF17_RS00775 (CHF17_00151) | - | 107972..108931 (+) | 960 | WP_001156316.1 | hypothetical protein | - |
| CHF17_RS00780 (CHF17_00152) | - | 108924..109433 (+) | 510 | WP_000032141.1 | ORF6C domain-containing protein | - |
| CHF17_RS11300 | - | 109466..109603 (+) | 138 | WP_000627309.1 | hypothetical protein | - |
| CHF17_RS11305 (CHF17_00153) | - | 109730..109876 (+) | 147 | WP_001867241.1 | hypothetical protein | - |
| CHF17_RS00785 (CHF17_00154) | - | 109839..110147 (-) | 309 | WP_001000651.1 | hypothetical protein | - |
| CHF17_RS00790 (CHF17_00155) | - | 110257..110514 (+) | 258 | WP_016480517.1 | hypothetical protein | - |
| CHF17_RS00795 (CHF17_00156) | - | 110543..110767 (+) | 225 | WP_047208982.1 | hypothetical protein | - |
| CHF17_RS00800 (CHF17_00157) | - | 110843..111601 (+) | 759 | WP_000546751.1 | DnaD domain protein | - |
| CHF17_RS00805 (CHF17_00158) | - | 111588..112370 (+) | 783 | WP_000600243.1 | ATP-binding protein | - |
| CHF17_RS11310 | - | 112361..112507 (+) | 147 | WP_165694407.1 | hypothetical protein | - |
| CHF17_RS00810 (CHF17_00159) | - | 112497..112772 (+) | 276 | WP_000431575.1 | hypothetical protein | - |
| CHF17_RS00815 (CHF17_00160) | - | 112759..113013 (+) | 255 | WP_047200442.1 | hypothetical protein | - |
| CHF17_RS00820 | - | 113015..113176 (+) | 162 | WP_079398808.1 | hypothetical protein | - |
| CHF17_RS00825 (CHF17_00161) | - | 113178..113507 (+) | 330 | WP_047200443.1 | hypothetical protein | - |
| CHF17_RS00830 (CHF17_00162) | - | 113510..114490 (+) | 981 | WP_047200444.1 | RecT family recombinase | - |
| CHF17_RS00835 (CHF17_00163) | - | 114487..115283 (+) | 797 | Protein_117 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| CHF17_RS00840 (CHF17_00164) | - | 115444..115641 (+) | 198 | WP_000474006.1 | hypothetical protein | - |
| CHF17_RS00845 (CHF17_00165) | - | 115631..116107 (+) | 477 | WP_000143298.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CHF17_RS00850 (CHF17_00166) | - | 116097..116444 (+) | 348 | WP_047200446.1 | hypothetical protein | - |
| CHF17_RS00855 (CHF17_00167) | - | 116456..116743 (+) | 288 | WP_047200447.1 | nucleotide modification associated domain-containing protein | - |
| CHF17_RS00860 (CHF17_00168) | - | 116727..117134 (+) | 408 | WP_047200448.1 | YopX family protein | - |
| CHF17_RS11315 (CHF17_00169) | - | 117258..117401 (+) | 144 | WP_000564611.1 | hypothetical protein | - |
| CHF17_RS00865 (CHF17_00170) | - | 117398..117919 (+) | 522 | WP_001019154.1 | DUF1642 domain-containing protein | - |
| CHF17_RS00870 (CHF17_00171) | - | 117916..118182 (+) | 267 | WP_000660740.1 | hypothetical protein | - |
| CHF17_RS00875 (CHF17_00172) | - | 118574..119008 (+) | 435 | WP_000142571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CHF17_RS11495 (CHF17_00173) | - | 119444..119572 (+) | 129 | WP_017647279.1 | hypothetical protein | - |
| CHF17_RS00885 (CHF17_00174) | - | 119626..120003 (-) | 378 | WP_000964195.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| CHF17_RS00890 (CHF17_00175) | - | 120056..120241 (-) | 186 | WP_001132272.1 | type II toxin-antitoxin system HicA family toxin | - |
| CHF17_RS00895 (CHF17_00176) | - | 120342..120677 (+) | 336 | WP_001247766.1 | HNH endonuclease signature motif containing protein | - |
| CHF17_RS00900 (CHF17_00177) | - | 120851..121318 (+) | 468 | WP_000532791.1 | phage terminase small subunit P27 family | - |
| CHF17_RS00905 (CHF17_00178) | - | 121333..123087 (+) | 1755 | WP_000151569.1 | terminase TerL endonuclease subunit | - |
| CHF17_RS00910 (CHF17_00179) | - | 123084..123263 (+) | 180 | WP_095725745.1 | hypothetical protein | - |
| CHF17_RS00915 (CHF17_00180) | - | 123247..123477 (+) | 231 | WP_001042284.1 | hypothetical protein | - |
| CHF17_RS00920 (CHF17_00181) | - | 123484..124704 (+) | 1221 | WP_000007732.1 | phage portal protein | - |
| CHF17_RS00925 (CHF17_00182) | - | 124682..125347 (+) | 666 | WP_001124818.1 | head maturation protease, ClpP-related | - |
| CHF17_RS00930 (CHF17_00183) | - | 125371..126555 (+) | 1185 | WP_000459130.1 | phage major capsid protein | - |
| CHF17_RS11320 | - | 126569..126730 (+) | 162 | WP_017285214.1 | hypothetical protein | - |
| CHF17_RS00935 (CHF17_00184) | - | 126733..127035 (+) | 303 | WP_000218659.1 | head-tail connector protein | - |
| CHF17_RS00940 | - | 127045..127371 (+) | 327 | WP_095725746.1 | head-tail adaptor protein | - |
| CHF17_RS00945 (CHF17_00185) | - | 127355..127732 (+) | 378 | WP_000160228.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| CHF17_RS00950 (CHF17_00186) | - | 127729..128154 (+) | 426 | WP_000559944.1 | hypothetical protein | - |
| CHF17_RS00955 (CHF17_00187) | - | 128170..128793 (+) | 624 | WP_000521118.1 | major tail protein | - |
| CHF17_RS00960 (CHF17_00188) | - | 128847..129167 (+) | 321 | WP_000273027.1 | hypothetical protein | - |
| CHF17_RS11325 | - | 129197..129364 (+) | 168 | WP_000264971.1 | hypothetical protein | - |
| CHF17_RS00965 (CHF17_00189) | - | 129377..133318 (+) | 3942 | WP_050977834.1 | phage tail tape measure protein | - |
| CHF17_RS00970 (CHF17_00190) | - | 133315..134838 (+) | 1524 | WP_050977835.1 | distal tail protein Dit | - |
| CHF17_RS00975 (CHF17_00191) | - | 134829..138955 (+) | 4127 | Protein_148 | phage tail protein | - |
| CHF17_RS00980 (CHF17_00193) | - | 138968..140959 (+) | 1992 | WP_000214867.1 | DUF859 family phage minor structural protein | - |
| CHF17_RS00985 (CHF17_00194) | - | 140973..141299 (+) | 327 | WP_000404431.1 | DUF1366 domain-containing protein | - |
| CHF17_RS00990 (CHF17_00195) | - | 141274..141486 (+) | 213 | WP_000698337.1 | hypothetical protein | - |
| CHF17_RS00995 (CHF17_00196) | - | 141499..141801 (+) | 303 | WP_000215499.1 | hypothetical protein | - |
| CHF17_RS01000 (CHF17_00197) | - | 141803..142057 (+) | 255 | WP_000611524.1 | phage holin | - |
| CHF17_RS01005 (CHF17_00199) | - | 142183..143517 (+) | 1335 | WP_000257233.1 | GH25 family lysozyme | - |
| CHF17_RS01010 (CHF17_00200) | - | 143882..144394 (+) | 513 | WP_000634505.1 | PBECR4 domain-containing protein | - |
| CHF17_RS01015 (CHF17_00201) | prx | 144623..144805 (+) | 183 | WP_000965649.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7024.13 Da Isoelectric Point: 4.1954
>NTDB_id=240478 CHF17_RS01015 WP_000965649.1 144623..144805(+) (prx) [Streptococcus agalactiae strain 874391]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=240478 CHF17_RS01015 WP_000965649.1 144623..144805(+) (prx) [Streptococcus agalactiae strain 874391]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS8232 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
68.333 |
0.483 |