Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C7M29_RS09825 Genome accession   NZ_CP028217
Coordinates   1909347..1909487 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM102751     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1904347..1914487
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M29_RS09795 (C7M29_01926) yueI 1904641..1905039 (+) 399 WP_015251331.1 YueI family protein -
  C7M29_RS09800 (C7M29_01927) pncA 1905136..1905687 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C7M29_RS09805 (C7M29_01928) pncB 1905703..1907175 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C7M29_RS09810 (C7M29_01929) pdeH 1907313..1908542 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C7M29_RS09815 (C7M29_01930) - 1908518..1908886 (-) 369 WP_003243784.1 hypothetical protein -
  C7M29_RS09820 - 1909000..1909125 (-) 126 WP_003228793.1 hypothetical protein -
  C7M29_RS09825 (C7M29_01931) degQ 1909347..1909487 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C7M29_RS09830 (C7M29_01932) comQ 1909672..1910541 (+) 870 WP_161476745.1 polyprenyl synthetase family protein Regulator
  C7M29_RS09835 (C7M29_01933) comX 1910538..1910759 (+) 222 WP_014114983.1 competence pheromone ComX -
  C7M29_RS09840 (C7M29_01934) comP 1910775..1913087 (+) 2313 WP_047183111.1 histidine kinase Regulator
  C7M29_RS09845 (C7M29_01935) comA 1913168..1913812 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C7M29_RS09850 (C7M29_01936) yuxO 1913831..1914211 (+) 381 WP_014477831.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=240348 C7M29_RS09825 WP_003220708.1 1909347..1909487(+) (degQ) [Bacillus subtilis strain SRCM102751]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=240348 C7M29_RS09825 WP_003220708.1 1909347..1909487(+) (degQ) [Bacillus subtilis strain SRCM102751]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment