Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C7M23_RS12055 Genome accession   NZ_CP028209
Coordinates   2308593..2308976 (+) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102745     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2303593..2313976
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M23_RS12020 (C7M23_02351) corA 2304046..2304999 (+) 954 WP_029317911.1 magnesium transporter CorA -
  C7M23_RS12025 (C7M23_02352) - 2305001..2305198 (+) 198 WP_014480259.1 CBS domain-containing protein -
  C7M23_RS12030 (C7M23_02354) comGA 2305411..2306481 (+) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  C7M23_RS12035 (C7M23_02355) comGB 2306468..2307505 (+) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  C7M23_RS12040 (C7M23_02356) comGC 2307519..2307815 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  C7M23_RS12045 (C7M23_02357) comGD 2307805..2308236 (+) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  C7M23_RS12050 (C7M23_02358) comGE 2308220..2308567 (+) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  C7M23_RS12055 comGF 2308593..2308976 (+) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  C7M23_RS12060 (C7M23_02360) comGG 2308977..2309351 (+) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  C7M23_RS12065 (C7M23_02361) spoIITA 2309422..2309601 (+) 180 WP_072175549.1 YqzE family protein -
  C7M23_RS12070 (C7M23_02362) yqzG 2309643..2309969 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M23_RS12075 (C7M23_02363) tapA 2310241..2311002 (+) 762 WP_131227614.1 amyloid fiber anchoring/assembly protein TapA -
  C7M23_RS12080 (C7M23_02364) sipW 2310986..2311558 (+) 573 WP_072692741.1 signal peptidase I SipW -
  C7M23_RS12085 (C7M23_02365) tasA 2311623..2312408 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M23_RS12090 (C7M23_02366) sinR 2312501..2312836 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M23_RS12095 (C7M23_02367) sinI 2312870..2313043 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=239765 C7M23_RS12055 WP_029317913.1 2308593..2308976(+) (comGF) [Bacillus subtilis strain SRCM102745]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=239765 C7M23_RS12055 WP_029317913.1 2308593..2308976(+) (comGF) [Bacillus subtilis strain SRCM102745]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCAATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment