Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | B2G65_RS04000 | Genome accession | NZ_CP022354 |
| Coordinates | 728993..729175 (+) | Length | 60 a.a. |
| NCBI ID | WP_032461122.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain GUR | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 693396..729175 | 728993..729175 | within | 0 |
Gene organization within MGE regions
Location: 693396..729175
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B2G65_RS03740 (B2G65_03740) | - | 693414..694256 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| B2G65_RS03745 (B2G65_03745) | - | 694234..694821 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| B2G65_RS03750 (B2G65_03750) | - | 694920..695195 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| B2G65_RS03755 (B2G65_03755) | - | 695285..696427 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| B2G65_RS03760 (B2G65_03760) | - | 696551..697069 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| B2G65_RS03765 (B2G65_03765) | - | 697081..697836 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| B2G65_RS03770 (B2G65_03770) | - | 698038..698250 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| B2G65_RS03775 (B2G65_03775) | - | 698520..698831 (+) | 312 | WP_010922478.1 | excisionase | - |
| B2G65_RS03780 (B2G65_03780) | - | 698833..699018 (+) | 186 | WP_023079923.1 | hypothetical protein | - |
| B2G65_RS10110 (B2G65_03785) | - | 699112..699381 (+) | 270 | WP_011106700.1 | replication protein | - |
| B2G65_RS03790 (B2G65_03790) | - | 699522..699908 (+) | 387 | WP_021733132.1 | DnaD domain-containing protein | - |
| B2G65_RS03795 (B2G65_03795) | - | 699889..700122 (+) | 234 | WP_093974631.1 | hypothetical protein | - |
| B2G65_RS03800 (B2G65_03800) | - | 700119..700259 (+) | 141 | WP_093974633.1 | hypothetical protein | - |
| B2G65_RS03805 (B2G65_03805) | - | 700268..700474 (+) | 207 | WP_093976075.1 | hypothetical protein | - |
| B2G65_RS03810 (B2G65_03810) | - | 700530..700859 (+) | 330 | WP_011017991.1 | hypothetical protein | - |
| B2G65_RS03815 (B2G65_03815) | - | 700862..701791 (+) | 930 | WP_053308489.1 | recombinase RecT | - |
| B2G65_RS03820 (B2G65_03820) | - | 701788..702585 (+) | 798 | WP_093974636.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| B2G65_RS03825 (B2G65_03825) | - | 702595..703344 (+) | 750 | WP_398577602.1 | N-6 DNA methylase | - |
| B2G65_RS03830 (B2G65_03830) | - | 703612..704031 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| B2G65_RS03835 (B2G65_03835) | - | 704140..704484 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| B2G65_RS03840 (B2G65_03840) | - | 704633..704989 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| B2G65_RS03845 (B2G65_03845) | - | 704986..706254 (+) | 1269 | WP_093974638.1 | phage portal protein | - |
| B2G65_RS03850 (B2G65_03850) | - | 706247..707740 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| B2G65_RS03855 (B2G65_03855) | - | 707746..707970 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| B2G65_RS03860 (B2G65_03860) | - | 708020..708199 (+) | 180 | WP_015055972.1 | hypothetical protein | - |
| B2G65_RS03865 (B2G65_03865) | - | 708192..708458 (+) | 267 | WP_093974640.1 | hypothetical protein | - |
| B2G65_RS03870 (B2G65_03870) | - | 708568..709982 (+) | 1415 | Protein_704 | terminase | - |
| B2G65_RS03875 (B2G65_03875) | - | 710063..710524 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| B2G65_RS03880 (B2G65_03880) | - | 710549..711460 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| B2G65_RS03885 (B2G65_03885) | - | 711460..711660 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| B2G65_RS03890 (B2G65_03890) | - | 711670..712092 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| B2G65_RS03895 (B2G65_03895) | - | 712052..712390 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| B2G65_RS03900 (B2G65_03900) | - | 712383..712619 (+) | 237 | WP_093974642.1 | hypothetical protein | - |
| B2G65_RS03905 (B2G65_03905) | - | 712620..712955 (+) | 336 | WP_093974644.1 | hypothetical protein | - |
| B2G65_RS03910 (B2G65_03910) | - | 712971..713561 (+) | 591 | WP_181876634.1 | phage tail protein | - |
| B2G65_RS03915 (B2G65_03915) | - | 713572..713835 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| B2G65_RS03920 (B2G65_03920) | - | 713850..714221 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| B2G65_RS03925 (B2G65_03925) | - | 714221..716578 (+) | 2358 | WP_093974648.1 | hypothetical protein | - |
| B2G65_RS03930 (B2G65_03930) | - | 716575..717270 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| B2G65_RS03935 (B2G65_03935) | - | 717267..719225 (+) | 1959 | WP_093974650.1 | phage tail spike protein | - |
| B2G65_RS03940 (B2G65_03940) | - | 719225..720334 (+) | 1110 | WP_093974653.1 | hyaluronoglucosaminidase | - |
| B2G65_RS03945 (B2G65_03945) | - | 720349..722133 (+) | 1785 | WP_093974655.1 | gp58-like family protein | - |
| B2G65_RS03950 (B2G65_03950) | - | 722145..722573 (+) | 429 | WP_093974657.1 | DUF1617 family protein | - |
| B2G65_RS03955 (B2G65_03955) | - | 722576..723208 (+) | 633 | WP_093974658.1 | hypothetical protein | - |
| B2G65_RS03960 (B2G65_03960) | - | 723218..723673 (+) | 456 | WP_002986151.1 | phage holin family protein | - |
| B2G65_RS03965 (B2G65_03965) | - | 723785..724993 (+) | 1209 | WP_093974660.1 | glucosaminidase domain-containing protein | - |
| B2G65_RS03970 (B2G65_03970) | - | 725133..725657 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| B2G65_RS03975 (B2G65_03975) | - | 725645..726511 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| B2G65_RS03980 (B2G65_03980) | spek | 726816..727595 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| B2G65_RS03990 (B2G65_03990) | - | 728071..728646 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| B2G65_RS04000 (B2G65_04000) | prx | 728993..729175 (+) | 183 | WP_032461122.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6977.86 Da Isoelectric Point: 4.0338
>NTDB_id=238686 B2G65_RS04000 WP_032461122.1 728993..729175(+) (prx) [Streptococcus pyogenes strain GUR]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=238686 B2G65_RS04000 WP_032461122.1 728993..729175(+) (prx) [Streptococcus pyogenes strain GUR]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |