Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | M6_RS06690 | Genome accession | NC_006086 |
| Coordinates | 1331461..1331643 (-) | Length | 60 a.a. |
| NCBI ID | WP_011018104.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS10394 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1331461..1355794 | 1331461..1331643 | within | 0 |
Gene organization within MGE regions
Location: 1331461..1355794
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6_RS06690 (M6_Spy1338) | prx | 1331461..1331643 (-) | 183 | WP_011018104.1 | hypothetical protein | Regulator |
| M6_RS06695 (M6_Spy1339) | sda | 1331883..1332881 (+) | 999 | WP_032463908.1 | streptodornase A | - |
| M6_RS06700 (M6_Spy1340) | - | 1333022..1333615 (-) | 594 | WP_003051628.1 | GNAT family N-acetyltransferase | - |
| M6_RS06705 (M6_Spy1341) | - | 1333615..1333779 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| M6_RS06710 (M6_Spy1342) | - | 1333928..1335133 (-) | 1206 | WP_011184795.1 | glucosaminidase domain-containing protein | - |
| M6_RS06720 (M6_Spy1343) | - | 1335246..1335431 (-) | 186 | WP_011184796.1 | holin | - |
| M6_RS06725 (M6_Spy1344) | - | 1335428..1335727 (-) | 300 | WP_011184797.1 | hypothetical protein | - |
| M6_RS06730 (M6_Spy1345) | - | 1335738..1336355 (-) | 618 | WP_011018111.1 | DUF1366 domain-containing protein | - |
| M6_RS06735 (M6_Spy1346) | - | 1336358..1336786 (-) | 429 | WP_011184798.1 | DUF1617 family protein | - |
| M6_RS06740 (M6_Spy1347) | - | 1336798..1338813 (-) | 2016 | WP_011184799.1 | gp58-like family protein | - |
| M6_RS06745 (M6_Spy1348) | - | 1338828..1339940 (-) | 1113 | WP_011184800.1 | hyaluronoglucosaminidase | - |
| M6_RS06750 (M6_Spy1349) | - | 1339940..1342087 (-) | 2148 | WP_011184801.1 | phage tail spike protein | - |
| M6_RS06755 (M6_Spy1350) | - | 1342084..1342800 (-) | 717 | WP_011018116.1 | distal tail protein Dit | - |
| M6_RS06760 (M6_Spy1351) | - | 1342797..1346057 (-) | 3261 | WP_021340629.1 | tape measure protein | - |
| M6_RS06765 (M6_Spy1352) | - | 1346047..1346628 (-) | 582 | WP_011018118.1 | bacteriophage Gp15 family protein | - |
| M6_RS06770 (M6_Spy1353) | - | 1346632..1347066 (-) | 435 | WP_011018119.1 | hypothetical protein | - |
| M6_RS06775 (M6_Spy1354) | - | 1347110..1347571 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| M6_RS06780 (M6_Spy1355) | - | 1347571..1347969 (-) | 399 | WP_011018121.1 | minor capsid protein | - |
| M6_RS06785 (M6_Spy1356) | - | 1347966..1348322 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| M6_RS06790 (M6_Spy1357) | - | 1348322..1348654 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| M6_RS06795 (M6_Spy1358) | - | 1348644..1349060 (-) | 417 | WP_011018123.1 | hypothetical protein | - |
| M6_RS06800 (M6_Spy1359) | - | 1349114..1349932 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| M6_RS06805 (M6_Spy1360) | - | 1349936..1350550 (-) | 615 | WP_010922079.1 | hypothetical protein | - |
| M6_RS06810 (M6_Spy1361) | - | 1350676..1350942 (-) | 267 | WP_010922078.1 | hypothetical protein | - |
| M6_RS06815 (M6_Spy1362) | - | 1351029..1351256 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| M6_RS06820 (M6_Spy1363) | - | 1351256..1352749 (-) | 1494 | WP_011018124.1 | phage minor capsid protein | - |
| M6_RS06825 (M6_Spy1364) | - | 1352754..1354256 (-) | 1503 | WP_011184804.1 | phage portal protein | - |
| M6_RS06830 (M6_Spy1365) | - | 1354270..1355561 (-) | 1292 | Protein_1330 | PBSX family phage terminase large subunit | - |
| M6_RS06835 (M6_Spy1366) | - | 1355564..1355794 (-) | 231 | WP_011184806.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6935.81 Da Isoelectric Point: 3.9417
>NTDB_id=23461 M6_RS06690 WP_011018104.1 1331461..1331643(-) (prx) [Streptococcus pyogenes MGAS10394]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=23461 M6_RS06690 WP_011018104.1 1331461..1331643(-) (prx) [Streptococcus pyogenes MGAS10394]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
93.023 |
71.667 |
0.667 |