Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | M6_RS06005 | Genome accession | NC_006086 |
| Coordinates | 1200261..1200443 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS10394 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1200261..1233773 | 1200261..1200443 | within | 0 |
Gene organization within MGE regions
Location: 1200261..1233773
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6_RS06005 (M6_Spy1194) | prx | 1200261..1200443 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| M6_RS06010 (M6_Spy1195) | mf2 | 1200683..1201441 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| M6_RS06015 (M6_Spy1196) | speC | 1201552..1202259 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| M6_RS10265 | - | 1202328..1202750 (-) | 423 | WP_410204536.1 | SH3 domain-containing protein | - |
| M6_RS06020 (M6_Spy1197) | - | 1202763..1204394 (-) | 1632 | Protein_1167 | IS1182 family transposase | - |
| M6_RS06025 (M6_Spy1198) | - | 1204433..1204642 (-) | 210 | WP_011184729.1 | hypothetical protein | - |
| M6_RS06035 (M6_Spy1199) | - | 1204760..1205215 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| M6_RS06040 (M6_Spy1200) | - | 1205225..1205836 (-) | 612 | WP_011184731.1 | DUF1366 domain-containing protein | - |
| M6_RS06045 (M6_Spy1201) | - | 1205839..1206267 (-) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| M6_RS06050 (M6_Spy1202) | - | 1206276..1208057 (-) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| M6_RS06055 (M6_Spy1203) | - | 1208072..1209181 (-) | 1110 | WP_011184734.1 | hyaluronoglucosaminidase | - |
| M6_RS06060 (M6_Spy1204) | - | 1209181..1211154 (-) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| M6_RS06065 (M6_Spy1205) | - | 1211136..1211831 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| M6_RS06070 (M6_Spy1206) | - | 1211828..1214191 (-) | 2364 | WP_011184735.1 | phage tail protein | - |
| M6_RS06075 (M6_Spy1207) | - | 1214191..1214562 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| M6_RS06080 (M6_Spy1208) | - | 1214577..1214840 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| M6_RS06085 (M6_Spy1209) | - | 1214851..1215441 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| M6_RS06090 (M6_Spy1210) | - | 1215457..1215792 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| M6_RS06095 (M6_Spy1211) | - | 1215793..1216029 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| M6_RS06100 (M6_Spy1212) | - | 1216022..1216360 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| M6_RS06105 (M6_Spy1213) | - | 1216320..1216742 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| M6_RS06110 (M6_Spy1214) | - | 1216752..1216952 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| M6_RS06115 (M6_Spy1215) | - | 1216952..1217863 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| M6_RS06120 (M6_Spy1216) | - | 1217888..1218349 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| M6_RS06125 (M6_Spy1217) | - | 1218430..1219845 (-) | 1416 | WP_011054685.1 | terminase | - |
| M6_RS06130 (M6_Spy1218) | - | 1219927..1220142 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| M6_RS06135 (M6_Spy1219) | - | 1220144..1220410 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| M6_RS10130 (M6_Spy1220) | - | 1220403..1220555 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| M6_RS06140 (M6_Spy1221) | - | 1220632..1220856 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| M6_RS06145 (M6_Spy1222) | - | 1220862..1222355 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| M6_RS06150 (M6_Spy1223) | - | 1222348..1223616 (-) | 1269 | WP_011184740.1 | phage portal protein | - |
| M6_RS06155 (M6_Spy1224) | - | 1223613..1223969 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| M6_RS06160 (M6_Spy1225) | - | 1224117..1224461 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| M6_RS06165 (M6_Spy1226) | - | 1224569..1224988 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| M6_RS06170 (M6_Spy1227) | - | 1225064..1225315 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| M6_RS10135 (M6_Spy1228) | - | 1225312..1225467 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| M6_RS06175 (M6_Spy1229) | - | 1225464..1225781 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| M6_RS06180 (M6_Spy1230) | - | 1225817..1226329 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| M6_RS06185 (M6_Spy1231) | - | 1226326..1226658 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| M6_RS10015 | - | 1226669..1226884 (-) | 216 | Protein_1202 | PcfJ domain-containing protein | - |
| M6_RS06190 (M6_Spy1232) | - | 1227045..1227440 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| M6_RS06195 (M6_Spy1234) | - | 1227805..1228602 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| M6_RS06200 (M6_Spy1235) | - | 1228595..1228795 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| M6_RS06205 (M6_Spy1236) | - | 1228792..1229718 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| M6_RS06210 (M6_Spy1237) | - | 1229721..1230050 (-) | 330 | WP_010922207.1 | hypothetical protein | - |
| M6_RS06215 (M6_Spy1238) | - | 1230106..1230312 (-) | 207 | WP_002990074.1 | hypothetical protein | - |
| M6_RS10020 (M6_Spy1239) | - | 1230321..1230461 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| M6_RS06220 (M6_Spy1240) | - | 1230458..1230691 (-) | 234 | WP_002988350.1 | hypothetical protein | - |
| M6_RS06225 (M6_Spy1241) | - | 1230672..1231058 (-) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| M6_RS06230 (M6_Spy1242) | - | 1231133..1231885 (+) | 753 | Protein_1212 | tyrosine-type recombinase/integrase | - |
| M6_RS06235 (M6_Spy1243) | - | 1231974..1232249 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| M6_RS06240 (M6_Spy1244) | - | 1232348..1232935 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| M6_RS06245 (M6_Spy1245) | - | 1232913..1233755 (-) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=23458 M6_RS06005 WP_011184726.1 1200261..1200443(-) (prx) [Streptococcus pyogenes MGAS10394]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=23458 M6_RS06005 WP_011184726.1 1200261..1200443(-) (prx) [Streptococcus pyogenes MGAS10394]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |