Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BB162_RS03210 | Genome accession | NZ_CP021869 |
| Coordinates | 549165..549344 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae strain SG-M6 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 508564..549344 | 549165..549344 | within | 0 |
Gene organization within MGE regions
Location: 508564..549344
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BB162_RS02945 (BB162_02945) | - | 508582..509421 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| BB162_RS02950 (BB162_02950) | - | 509396..509998 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| BB162_RS02955 (BB162_02955) | - | 510101..510376 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| BB162_RS02960 (BB162_02960) | - | 510464..511606 (-) | 1143 | WP_000269472.1 | tyrosine-type recombinase/integrase | - |
| BB162_RS02965 (BB162_02965) | - | 511721..512272 (-) | 552 | WP_000353930.1 | hypothetical protein | - |
| BB162_RS02970 (BB162_02970) | - | 512290..512676 (-) | 387 | WP_000151182.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BB162_RS02975 (BB162_02975) | - | 512680..513027 (-) | 348 | WP_000484457.1 | helix-turn-helix domain-containing protein | - |
| BB162_RS02980 (BB162_02980) | - | 513323..513568 (+) | 246 | WP_000739596.1 | hypothetical protein | - |
| BB162_RS02985 (BB162_02985) | - | 513519..514307 (-) | 789 | WP_000092750.1 | hypothetical protein | - |
| BB162_RS02990 (BB162_02990) | - | 514358..514549 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| BB162_RS02995 (BB162_02995) | - | 514629..514940 (+) | 312 | WP_001123482.1 | hypothetical protein | - |
| BB162_RS11180 | - | 514945..515094 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| BB162_RS03000 (BB162_03000) | - | 515088..515315 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| BB162_RS03005 (BB162_03005) | - | 515308..515538 (+) | 231 | WP_000573547.1 | hypothetical protein | - |
| BB162_RS03010 (BB162_03010) | - | 515522..516841 (+) | 1320 | WP_000156426.1 | AAA family ATPase | - |
| BB162_RS03015 (BB162_03015) | - | 516856..517929 (+) | 1074 | WP_001167564.1 | ATP-binding protein | - |
| BB162_RS03020 (BB162_03020) | - | 518025..518630 (+) | 606 | WP_000141564.1 | hypothetical protein | - |
| BB162_RS03025 (BB162_03025) | - | 518630..519238 (+) | 609 | WP_001870729.1 | hypothetical protein | - |
| BB162_RS03030 (BB162_03030) | - | 519244..520827 (+) | 1584 | WP_032456395.1 | DEAD/DEAH box helicase | - |
| BB162_RS03035 (BB162_03035) | - | 520836..521033 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| BB162_RS03040 (BB162_03040) | - | 521026..521277 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| BB162_RS03045 (BB162_03045) | - | 521348..523627 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| BB162_RS03050 (BB162_03050) | - | 523997..524194 (+) | 198 | WP_000666342.1 | crAss001_48 related protein | - |
| BB162_RS03055 (BB162_03055) | - | 524221..524619 (+) | 399 | WP_000151204.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BB162_RS03060 (BB162_03060) | - | 524616..524831 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| BB162_RS03065 (BB162_03065) | - | 524828..525064 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| BB162_RS03070 (BB162_03070) | - | 525061..525291 (+) | 231 | WP_001005355.1 | hypothetical protein | - |
| BB162_RS03075 (BB162_03075) | - | 525294..525626 (+) | 333 | WP_000052302.1 | hypothetical protein | - |
| BB162_RS03080 (BB162_03080) | - | 525704..526117 (+) | 414 | WP_000041038.1 | transcriptional regulator | - |
| BB162_RS03085 (BB162_03085) | - | 526238..526669 (+) | 432 | WP_000041103.1 | terminase small subunit | - |
| BB162_RS03090 (BB162_03090) | - | 526659..527939 (+) | 1281 | WP_000208745.1 | PBSX family phage terminase large subunit | - |
| BB162_RS03095 (BB162_03095) | - | 528017..529483 (+) | 1467 | WP_370657591.1 | phage portal protein | - |
| BB162_RS03100 (BB162_03100) | - | 529443..530891 (+) | 1449 | WP_032459253.1 | phage head morphogenesis protein | - |
| BB162_RS11405 (BB162_03105) | - | 530919..531107 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| BB162_RS03110 (BB162_03110) | - | 531112..531315 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| BB162_RS03115 (BB162_03115) | - | 531458..532027 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| BB162_RS11185 (BB162_03120) | - | 532046..532942 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| BB162_RS03125 (BB162_03125) | - | 532948..533304 (+) | 357 | WP_000356705.1 | phage head-tail connector protein | - |
| BB162_RS03130 (BB162_03130) | - | 533315..533593 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| BB162_RS03135 (BB162_03135) | - | 533590..533934 (+) | 345 | WP_000060408.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BB162_RS03140 (BB162_03140) | - | 533938..534297 (+) | 360 | WP_000640604.1 | hypothetical protein | - |
| BB162_RS03145 (BB162_03145) | - | 534309..534941 (+) | 633 | WP_000450517.1 | phage major tail protein, TP901-1 family | - |
| BB162_RS03150 (BB162_03150) | - | 534992..535447 (+) | 456 | WP_000424190.1 | tail assembly chaperone | - |
| BB162_RS03155 (BB162_03155) | - | 535522..535752 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| BB162_RS03160 (BB162_03160) | - | 535781..540007 (+) | 4227 | WP_000929196.1 | tape measure protein | - |
| BB162_RS03165 (BB162_03165) | - | 540020..540862 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| BB162_RS03170 (BB162_03170) | - | 540875..544702 (+) | 3828 | WP_000206522.1 | phage tail protein | - |
| BB162_RS11190 | - | 544711..544863 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| BB162_RS03175 (BB162_03175) | - | 544874..545290 (+) | 417 | WP_001873936.1 | DUF1366 domain-containing protein | - |
| BB162_RS11195 | - | 545353..545514 (+) | 162 | WP_000222556.1 | hypothetical protein | - |
| BB162_RS03180 (BB162_03180) | - | 545524..545820 (+) | 297 | WP_000564987.1 | hypothetical protein | - |
| BB162_RS03185 (BB162_03185) | - | 545822..546160 (+) | 339 | WP_001001962.1 | phage holin | - |
| BB162_RS03190 (BB162_03190) | - | 546162..546881 (+) | 720 | WP_000236382.1 | peptidoglycan amidohydrolase family protein | - |
| BB162_RS03195 (BB162_03195) | - | 547220..548179 (+) | 960 | WP_000829578.1 | Abi family protein | - |
| BB162_RS03200 (BB162_03200) | - | 548334..548534 (+) | 201 | WP_000076696.1 | CsbD family protein | - |
| BB162_RS03205 (BB162_03205) | - | 548575..548745 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| BB162_RS11360 | - | 548881..549006 (-) | 126 | WP_017285425.1 | hypothetical protein | - |
| BB162_RS03210 (BB162_03210) | prx | 549165..549344 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=234220 BB162_RS03210 WP_000965651.1 549165..549344(+) (prx) [Streptococcus agalactiae strain SG-M6]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=234220 BB162_RS03210 WP_000965651.1 549165..549344(+) (prx) [Streptococcus agalactiae strain SG-M6]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |