Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M6_RS00495 | Genome accession | NC_006086 |
| Coordinates | 75042..75224 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS10394 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12775..87784 | 75042..75224 | within | 0 |
Gene organization within MGE regions
Location: 12775..87784
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6_RS00060 (M6_Spy0013) | ftsH | 12775..14754 (+) | 1980 | WP_002981901.1 | ATP-dependent zinc metalloprotease FtsH | - |
| M6_RS00065 (M6_Spy0014) | - | 14950..15957 (-) | 1008 | WP_011184045.1 | IS30-like element IS1239 family transposase | - |
| M6_RS00070 (M6_Spy0015) | - | 16167..17558 (+) | 1392 | WP_002987685.1 | APC family permease | - |
| M6_RS00245 (M6_Spy0017) | pcsB | 32114..33310 (+) | 1197 | WP_011017226.1 | peptidoglycan hydrolase PcsB | - |
| M6_RS00250 (M6_Spy0018) | - | 33563..34525 (+) | 963 | WP_002986722.1 | ribose-phosphate diphosphokinase | - |
| M6_RS00255 (M6_Spy0019) | recO | 34711..35466 (+) | 756 | WP_002986719.1 | DNA repair protein RecO | - |
| M6_RS00260 (M6_Spy0020) | - | 35599..36687 (-) | 1089 | WP_011054900.1 | site-specific integrase | - |
| M6_RS00265 (M6_Spy0021) | - | 36863..37414 (-) | 552 | WP_011054899.1 | hypothetical protein | - |
| M6_RS00270 (M6_Spy0022) | - | 37425..37808 (-) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M6_RS00275 (M6_Spy0023) | - | 37822..38172 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| M6_RS00280 (M6_Spy0024) | - | 38811..39002 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| M6_RS00285 (M6_Spy0025) | - | 39053..39253 (+) | 201 | WP_011184050.1 | hypothetical protein | - |
| M6_RS00290 (M6_Spy0026) | - | 39341..39598 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| M6_RS09470 | - | 39627..39797 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| M6_RS00295 (M6_Spy0027) | - | 39790..39997 (+) | 208 | Protein_26 | hypothetical protein | - |
| M6_RS00300 (M6_Spy0028) | - | 39994..40377 (+) | 384 | WP_011054892.1 | hypothetical protein | - |
| M6_RS00305 (M6_Spy0030) | - | 40523..40726 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| M6_RS00310 (M6_Spy0031) | - | 40814..41113 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| M6_RS00315 (M6_Spy0032) | - | 41113..42270 (+) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| M6_RS00320 (M6_Spy0033) | - | 42284..42847 (+) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| M6_RS00325 (M6_Spy0034) | - | 42890..44812 (+) | 1923 | WP_011054887.1 | DNA polymerase | - |
| M6_RS00330 (M6_Spy0035) | - | 44817..47201 (+) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| M6_RS00335 (M6_Spy0036) | - | 47567..47842 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| M6_RS00340 (M6_Spy0037) | - | 47839..49161 (+) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| M6_RS10065 (M6_Spy0038) | - | 49162..49332 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| M6_RS00345 (M6_Spy0039) | - | 49325..49597 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| M6_RS00350 (M6_Spy0040) | - | 49730..50146 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| M6_RS00355 (M6_Spy0041) | - | 50236..50688 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| M6_RS00360 (M6_Spy0042) | - | 50678..51955 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| M6_RS00365 (M6_Spy0043) | - | 51971..53503 (+) | 1533 | WP_011106638.1 | phage portal protein | - |
| M6_RS00370 (M6_Spy0044) | - | 53463..54911 (+) | 1449 | WP_011054877.1 | minor capsid protein | - |
| M6_RS00375 (M6_Spy0045) | - | 54939..55127 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| M6_RS00380 (M6_Spy0046) | - | 55132..55398 (+) | 267 | WP_011054875.1 | hypothetical protein | - |
| M6_RS00385 (M6_Spy0047) | - | 55566..56135 (+) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| M6_RS00390 (M6_Spy0048) | - | 56148..57035 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| M6_RS00395 (M6_Spy0049) | - | 57047..57403 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| M6_RS00400 (M6_Spy0050) | - | 57414..57692 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| M6_RS00405 (M6_Spy0051) | - | 57689..58033 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M6_RS00410 (M6_Spy0052) | - | 58037..58396 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| M6_RS00415 (M6_Spy0053) | - | 58408..59007 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| M6_RS00420 (M6_Spy0054) | - | 59061..59516 (+) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| M6_RS00425 (M6_Spy0055) | - | 59591..59824 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| M6_RS00430 (M6_Spy0056) | - | 59839..64221 (+) | 4383 | WP_011054866.1 | tape measure protein | - |
| M6_RS00435 (M6_Spy0057) | - | 64233..65075 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| M6_RS00440 (M6_Spy0058) | - | 65085..67064 (+) | 1980 | WP_011054864.1 | phage tail protein | - |
| M6_RS00445 (M6_Spy0059) | - | 67061..68068 (+) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| M6_RS00450 (M6_Spy0060) | - | 68078..69985 (+) | 1908 | WP_011184055.1 | gp58-like family protein | - |
| M6_RS00455 (M6_Spy0061) | - | 69997..70434 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| M6_RS00460 (M6_Spy0062) | - | 70431..71048 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| M6_RS00465 (M6_Spy0063) | - | 71058..71330 (+) | 273 | WP_002986916.1 | DUF7365 family protein | - |
| M6_RS00470 (M6_Spy0064) | - | 71327..71554 (+) | 228 | WP_003058873.1 | phage holin | - |
| M6_RS00480 (M6_Spy0065) | - | 71670..72872 (+) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| M6_RS00485 (M6_Spy0066) | - | 73194..73709 (+) | 516 | WP_023077389.1 | hypothetical protein | - |
| M6_RS00490 (M6_Spy0067) | - | 73823..74809 (-) | 987 | WP_011184058.1 | DNA/RNA non-specific endonuclease | - |
| M6_RS00495 (M6_Spy0068) | prx | 75042..75224 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| M6_RS00500 (M6_Spy0069) | plsX | 75463..76470 (+) | 1008 | WP_011184059.1 | phosphate acyltransferase PlsX | - |
| M6_RS00505 (M6_Spy0070) | - | 76463..76705 (+) | 243 | WP_002993445.1 | phosphopantetheine-binding protein | - |
| M6_RS00510 (M6_Spy0071) | purC | 76857..77561 (+) | 705 | WP_027968831.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| M6_RS00515 (M6_Spy0072) | - | 77685..81410 (+) | 3726 | WP_021340241.1 | phosphoribosylformylglycinamidine synthase | - |
| M6_RS00520 (M6_Spy0073) | purF | 81644..83098 (+) | 1455 | WP_009880323.1 | amidophosphoribosyltransferase | - |
| M6_RS00525 (M6_Spy0074) | purM | 83126..84148 (+) | 1023 | WP_011184062.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| M6_RS00530 (M6_Spy0075) | purN | 84316..84870 (+) | 555 | WP_002986700.1 | phosphoribosylglycinamide formyltransferase | - |
| M6_RS00535 (M6_Spy0076) | purH | 85054..86601 (+) | 1548 | WP_011184063.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| M6_RS00540 (M6_Spy0077) | - | 86660..87784 (-) | 1125 | WP_011184064.1 | CHAP domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=23422 M6_RS00495 WP_011054856.1 75042..75224(+) (prx) [Streptococcus pyogenes MGAS10394]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=23422 M6_RS00495 WP_011054856.1 75042..75224(+) (prx) [Streptococcus pyogenes MGAS10394]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |