Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BB159_RS03510 | Genome accession | NZ_CP021868 |
| Coordinates | 623204..623392 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain SG-M8 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 614015..622769 | 623204..623392 | flank | 435 |
| IS/Tn | 622158..622769 | 623204..623392 | flank | 435 |
Gene organization within MGE regions
Location: 614015..623392
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BB159_RS03455 (BB159_03455) | - | 614015..614281 (-) | 267 | WP_001872365.1 | hypothetical protein | - |
| BB159_RS11410 | - | 614287..615664 (+) | 1378 | Protein_591 | IS3 family transposase | - |
| BB159_RS03470 (BB159_03470) | - | 615837..615998 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| BB159_RS03475 (BB159_03475) | - | 616740..618017 (+) | 1278 | WP_000594367.1 | ABC transporter permease | - |
| BB159_RS03480 (BB159_03480) | - | 618027..618683 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| BB159_RS03485 (BB159_03485) | - | 618683..620059 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| BB159_RS03490 (BB159_03490) | - | 620156..620809 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| BB159_RS03495 (BB159_03495) | - | 620806..622106 (+) | 1301 | Protein_597 | GHKL domain-containing protein | - |
| BB159_RS03500 (BB159_03500) | - | 622158..622805 (-) | 648 | Protein_598 | IS3 family transposase | - |
| BB159_RS03505 (BB159_03505) | - | 622983..623162 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| BB159_RS03510 (BB159_03510) | prx | 623204..623392 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=234172 BB159_RS03510 WP_000027835.1 623204..623392(+) (prx) [Streptococcus agalactiae strain SG-M8]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=234172 BB159_RS03510 WP_000027835.1 623204..623392(+) (prx) [Streptococcus agalactiae strain SG-M8]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |