Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BB268_RS03550 | Genome accession | NZ_CP021866 |
| Coordinates | 619566..619754 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain SG-M29 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 610780..619524 | 619566..619754 | flank | 42 |
| IS/Tn | 618499..619110 | 619566..619754 | flank | 456 |
Gene organization within MGE regions
Location: 610780..619754
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BB268_RS03510 (BB268_03510) | - | 612159..612320 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| BB268_RS03515 (BB268_03515) | - | 613062..614339 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| BB268_RS03520 (BB268_03520) | - | 614349..615005 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| BB268_RS03525 (BB268_03525) | - | 615005..616381 (+) | 1377 | WP_017647836.1 | ABC transporter permease | - |
| BB268_RS03530 (BB268_03530) | - | 616478..617131 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| BB268_RS03535 (BB268_03535) | - | 617128..618447 (+) | 1320 | WP_000734169.1 | sensor histidine kinase | - |
| BB268_RS03540 (BB268_03540) | - | 618499..619146 (-) | 648 | Protein_606 | IS3 family transposase | - |
| BB268_RS03545 (BB268_03545) | - | 619324..619524 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| BB268_RS03550 (BB268_03550) | prx | 619566..619754 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=234070 BB268_RS03550 WP_000027835.1 619566..619754(+) (prx) [Streptococcus agalactiae strain SG-M29]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=234070 BB268_RS03550 WP_000027835.1 619566..619754(+) (prx) [Streptococcus agalactiae strain SG-M29]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |