Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BB313_RS06265 | Genome accession | NZ_CP021865 |
| Coordinates | 1185112..1185294 (-) | Length | 60 a.a. |
| NCBI ID | WP_017647839.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain SG-M50 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1185112..1237313 | 1185112..1185294 | within | 0 |
Gene organization within MGE regions
Location: 1185112..1237313
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BB313_RS06265 (BB313_06245) | prx | 1185112..1185294 (-) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| BB313_RS06270 (BB313_06250) | - | 1185417..1185626 (-) | 210 | WP_000424774.1 | helix-turn-helix domain-containing protein | - |
| BB313_RS11320 | - | 1185776..1185922 (+) | 147 | WP_001030869.1 | hypothetical protein | - |
| BB313_RS06275 (BB313_06255) | - | 1186063..1186314 (+) | 252 | WP_000455662.1 | hypothetical protein | - |
| BB313_RS06280 (BB313_06260) | - | 1186458..1187792 (-) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| BB313_RS06285 (BB313_06265) | - | 1187918..1188145 (-) | 228 | WP_000609111.1 | phage holin | - |
| BB313_RS06290 (BB313_06270) | - | 1188138..1188440 (-) | 303 | WP_017647841.1 | hypothetical protein | - |
| BB313_RS11545 | - | 1188449..1188577 (-) | 129 | WP_017647842.1 | hypothetical protein | - |
| BB313_RS06295 (BB313_06275) | - | 1188600..1188992 (-) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| BB313_RS06300 (BB313_06280) | - | 1189004..1191007 (-) | 2004 | WP_053515051.1 | DUF859 family phage minor structural protein | - |
| BB313_RS06305 (BB313_06285) | - | 1191008..1195129 (-) | 4122 | WP_053515064.1 | glucosaminidase domain-containing protein | - |
| BB313_RS06310 (BB313_06290) | - | 1195130..1196662 (-) | 1533 | WP_000228809.1 | distal tail protein Dit | - |
| BB313_RS06315 (BB313_06295) | - | 1196656..1198668 (-) | 2013 | WP_053515065.1 | phage tail protein | - |
| BB313_RS06320 (BB313_06300) | - | 1198668..1199039 (-) | 372 | WP_000916437.1 | DUF5361 domain-containing protein | - |
| BB313_RS06325 (BB313_06305) | - | 1199054..1199299 (-) | 246 | WP_000858406.1 | hypothetical protein | - |
| BB313_RS06330 (BB313_06310) | - | 1199299..1199856 (-) | 558 | WP_000226353.1 | tail protein | - |
| BB313_RS06335 (BB313_06315) | - | 1199866..1200201 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| BB313_RS06340 (BB313_06320) | - | 1200202..1200438 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| BB313_RS06345 (BB313_06325) | - | 1200431..1200769 (-) | 339 | WP_025194588.1 | hypothetical protein | - |
| BB313_RS06350 (BB313_06330) | - | 1200729..1201151 (-) | 423 | WP_000180798.1 | phage Gp19/Gp15/Gp42 family protein | - |
| BB313_RS06355 (BB313_06335) | - | 1201165..1201380 (-) | 216 | WP_000640308.1 | hypothetical protein | - |
| BB313_RS06360 (BB313_06340) | - | 1201377..1202279 (-) | 903 | WP_000841023.1 | phage major capsid protein | - |
| BB313_RS06365 (BB313_06345) | - | 1202282..1202746 (-) | 465 | WP_001288695.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| BB313_RS06370 (BB313_06350) | - | 1202827..1204242 (-) | 1416 | WP_000256853.1 | terminase large subunit | - |
| BB313_RS06375 (BB313_06355) | - | 1204351..1204539 (-) | 189 | WP_000421992.1 | hypothetical protein | - |
| BB313_RS06380 (BB313_06360) | - | 1204539..1205759 (-) | 1221 | WP_000227332.1 | polymorphic toxin type 50 domain-containing protein | - |
| BB313_RS06385 (BB313_06365) | - | 1205752..1207020 (-) | 1269 | WP_001108671.1 | phage portal protein | - |
| BB313_RS06390 (BB313_06370) | - | 1207017..1207373 (-) | 357 | WP_000725957.1 | hypothetical protein | - |
| BB313_RS06395 (BB313_06375) | - | 1207525..1207902 (-) | 378 | WP_000225343.1 | HNH endonuclease | - |
| BB313_RS06400 (BB313_06380) | - | 1208196..1208621 (-) | 426 | WP_000533372.1 | DUF1492 domain-containing protein | - |
| BB313_RS06405 (BB313_06385) | - | 1209010..1209276 (-) | 267 | WP_017647858.1 | hypothetical protein | - |
| BB313_RS06410 (BB313_06390) | - | 1209294..1209593 (-) | 300 | WP_001105090.1 | hypothetical protein | - |
| BB313_RS06415 (BB313_06395) | - | 1209614..1210141 (-) | 528 | WP_017647942.1 | DUF1642 domain-containing protein | - |
| BB313_RS06420 (BB313_06400) | - | 1210145..1210636 (-) | 492 | WP_017285439.1 | hypothetical protein | - |
| BB313_RS06425 (BB313_06405) | - | 1210641..1211126 (-) | 486 | WP_017647943.1 | class I SAM-dependent methyltransferase | - |
| BB313_RS06430 (BB313_06410) | - | 1211129..1211398 (-) | 270 | WP_017647862.1 | hypothetical protein | - |
| BB313_RS06435 (BB313_06415) | - | 1211395..1211559 (-) | 165 | WP_017647863.1 | hypothetical protein | - |
| BB313_RS06440 (BB313_06420) | - | 1211556..1211939 (-) | 384 | WP_017647864.1 | YopX family protein | - |
| BB313_RS11325 | - | 1211936..1212094 (-) | 159 | WP_017647865.1 | hypothetical protein | - |
| BB313_RS06445 (BB313_06425) | - | 1212078..1212374 (-) | 297 | WP_017647866.1 | nucleotide modification associated domain-containing protein | - |
| BB313_RS06450 (BB313_06430) | - | 1212386..1212733 (-) | 348 | WP_017647944.1 | hypothetical protein | - |
| BB313_RS06455 (BB313_06435) | - | 1212723..1213199 (-) | 477 | WP_017647868.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BB313_RS06460 (BB313_06440) | - | 1213189..1213386 (-) | 198 | WP_017647869.1 | hypothetical protein | - |
| BB313_RS06465 (BB313_06445) | - | 1213549..1214346 (-) | 798 | WP_017647870.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| BB313_RS06470 (BB313_06450) | - | 1214343..1215296 (-) | 954 | WP_000064172.1 | recombinase RecT | - |
| BB313_RS06475 (BB313_06455) | - | 1215297..1215545 (-) | 249 | WP_053515066.1 | hypothetical protein | - |
| BB313_RS06480 (BB313_06460) | - | 1215532..1215807 (-) | 276 | WP_017647873.1 | hypothetical protein | - |
| BB313_RS11330 | - | 1215800..1215943 (-) | 144 | WP_017647874.1 | hypothetical protein | - |
| BB313_RS06485 (BB313_06465) | - | 1215934..1216716 (-) | 783 | WP_000600244.1 | ATP-binding protein | - |
| BB313_RS06490 (BB313_06470) | - | 1216703..1217461 (-) | 759 | WP_000546751.1 | DnaD domain protein | - |
| BB313_RS11335 | - | 1217490..1217633 (-) | 144 | WP_017647875.1 | hypothetical protein | - |
| BB313_RS06495 (BB313_06475) | - | 1217663..1217920 (-) | 258 | WP_001191791.1 | hypothetical protein | - |
| BB313_RS06500 (BB313_06480) | - | 1218049..1218342 (+) | 294 | WP_001104373.1 | hypothetical protein | - |
| BB313_RS11340 | - | 1218339..1218497 (-) | 159 | WP_017647876.1 | hypothetical protein | - |
| BB313_RS06505 (BB313_06485) | - | 1218530..1219258 (-) | 729 | WP_017647877.1 | phage antirepressor KilAC domain-containing protein | - |
| BB313_RS06510 (BB313_06490) | - | 1219306..1219506 (-) | 201 | WP_001875236.1 | helix-turn-helix transcriptional regulator | - |
| BB313_RS06515 (BB313_06495) | - | 1219695..1220054 (+) | 360 | WP_000207087.1 | helix-turn-helix domain-containing protein | - |
| BB313_RS06520 (BB313_06500) | - | 1220044..1220424 (+) | 381 | WP_000686776.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BB313_RS06525 (BB313_06505) | - | 1220477..1220686 (+) | 210 | WP_000520183.1 | TM2 domain-containing protein | - |
| BB313_RS06530 (BB313_06510) | - | 1220863..1221960 (+) | 1098 | WP_000570848.1 | site-specific integrase | - |
| BB313_RS06535 (BB313_06515) | hylB | 1222239..1225457 (+) | 3219 | WP_017647747.1 | hyaluronate lyase | - |
| BB313_RS06540 (BB313_06520) | rfbB | 1225509..1226555 (-) | 1047 | WP_000134282.1 | dTDP-glucose 4,6-dehydratase | - |
| BB313_RS06545 (BB313_06525) | - | 1226762..1227355 (-) | 594 | WP_000139163.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| BB313_RS06550 (BB313_06530) | rfbA | 1227355..1228224 (-) | 870 | WP_000676114.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| BB313_RS06555 (BB313_06535) | - | 1228283..1229386 (-) | 1104 | WP_000716829.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| BB313_RS06560 (BB313_06540) | - | 1229395..1230183 (-) | 789 | WP_000647415.1 | Nif3-like dinuclear metal center hexameric protein | - |
| BB313_RS06565 (BB313_06545) | - | 1230173..1230856 (-) | 684 | WP_000365673.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| BB313_RS06570 (BB313_06550) | - | 1230960..1231640 (-) | 681 | WP_000221657.1 | DnaD domain-containing protein | - |
| BB313_RS06575 (BB313_06555) | - | 1231758..1232276 (-) | 519 | WP_000365343.1 | adenine phosphoribosyltransferase | - |
| BB313_RS06580 (BB313_06560) | - | 1232399..1234963 (-) | 2565 | WP_017647748.1 | GBS Bsp-like repeat-containing protein | - |
| BB313_RS06590 (BB313_06570) | recJ | 1235115..1237313 (-) | 2199 | WP_000622242.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6933.00 Da Isoelectric Point: 4.2702
>NTDB_id=234032 BB313_RS06265 WP_017647839.1 1185112..1185294(-) (prx) [Streptococcus agalactiae strain SG-M50]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=234032 BB313_RS06265 WP_017647839.1 1185112..1185294(-) (prx) [Streptococcus agalactiae strain SG-M50]
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |