Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BB194_RS06265 | Genome accession | NZ_CP021864 |
| Coordinates | 1185114..1185296 (-) | Length | 60 a.a. |
| NCBI ID | WP_017647839.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain SG-M158 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1185114..1237315 | 1185114..1185296 | within | 0 |
Gene organization within MGE regions
Location: 1185114..1237315
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BB194_RS06265 (BB194_06250) | prx | 1185114..1185296 (-) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| BB194_RS06270 (BB194_06255) | - | 1185419..1185628 (-) | 210 | WP_000424774.1 | helix-turn-helix transcriptional regulator | - |
| BB194_RS11330 | - | 1185778..1185924 (+) | 147 | WP_001030869.1 | hypothetical protein | - |
| BB194_RS06275 (BB194_06260) | - | 1186065..1186316 (+) | 252 | WP_000455662.1 | hypothetical protein | - |
| BB194_RS06280 (BB194_06265) | - | 1186460..1187794 (-) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| BB194_RS06285 (BB194_06270) | - | 1187920..1188147 (-) | 228 | WP_000609111.1 | phage holin | - |
| BB194_RS06290 (BB194_06275) | - | 1188140..1188442 (-) | 303 | WP_017647841.1 | hypothetical protein | - |
| BB194_RS11555 | - | 1188451..1188579 (-) | 129 | WP_017647842.1 | hypothetical protein | - |
| BB194_RS06295 (BB194_06280) | - | 1188602..1188994 (-) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| BB194_RS06300 (BB194_06285) | - | 1189006..1191009 (-) | 2004 | WP_053515051.1 | DUF859 family phage minor structural protein | - |
| BB194_RS06305 (BB194_06290) | - | 1191010..1195131 (-) | 4122 | WP_053515064.1 | glucosaminidase domain-containing protein | - |
| BB194_RS06310 (BB194_06295) | - | 1195132..1196664 (-) | 1533 | WP_000228809.1 | distal tail protein Dit | - |
| BB194_RS06315 (BB194_06300) | - | 1196658..1198670 (-) | 2013 | WP_053515065.1 | PblA | - |
| BB194_RS06320 (BB194_06305) | - | 1198670..1199041 (-) | 372 | WP_000916437.1 | DUF5361 domain-containing protein | - |
| BB194_RS06325 (BB194_06310) | - | 1199056..1199301 (-) | 246 | WP_000858406.1 | hypothetical protein | - |
| BB194_RS06330 (BB194_06315) | - | 1199301..1199858 (-) | 558 | WP_000226353.1 | tail protein | - |
| BB194_RS06335 (BB194_06320) | - | 1199868..1200203 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| BB194_RS06340 (BB194_06325) | - | 1200204..1200440 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| BB194_RS06345 (BB194_06330) | - | 1200433..1200771 (-) | 339 | WP_025194588.1 | hypothetical protein | - |
| BB194_RS06350 (BB194_06335) | - | 1200731..1201153 (-) | 423 | WP_000180798.1 | phage Gp19/Gp15/Gp42 family protein | - |
| BB194_RS06355 (BB194_06340) | - | 1201167..1201382 (-) | 216 | WP_000640308.1 | hypothetical protein | - |
| BB194_RS06360 (BB194_06345) | - | 1201379..1202281 (-) | 903 | WP_000841023.1 | phage major capsid protein | - |
| BB194_RS06365 (BB194_06350) | - | 1202284..1202748 (-) | 465 | WP_001288695.1 | DUF4355 domain-containing protein | - |
| BB194_RS06370 (BB194_06355) | - | 1202829..1204244 (-) | 1416 | WP_000256853.1 | terminase large subunit | - |
| BB194_RS06375 (BB194_06360) | - | 1204353..1204541 (-) | 189 | WP_000421992.1 | hypothetical protein | - |
| BB194_RS06380 (BB194_06365) | - | 1204541..1205761 (-) | 1221 | WP_000227332.1 | polymorphic toxin type 50 domain-containing protein | - |
| BB194_RS06385 (BB194_06370) | - | 1205754..1207022 (-) | 1269 | WP_001108671.1 | phage portal protein | - |
| BB194_RS06390 (BB194_06375) | - | 1207019..1207375 (-) | 357 | WP_000725957.1 | hypothetical protein | - |
| BB194_RS06395 (BB194_06380) | - | 1207527..1207904 (-) | 378 | WP_000225343.1 | HNH endonuclease signature motif containing protein | - |
| BB194_RS06400 (BB194_06385) | - | 1208198..1208623 (-) | 426 | WP_000533372.1 | DUF1492 domain-containing protein | - |
| BB194_RS06405 (BB194_06390) | - | 1209012..1209278 (-) | 267 | WP_017647858.1 | hypothetical protein | - |
| BB194_RS06410 (BB194_06395) | - | 1209296..1209595 (-) | 300 | WP_001105090.1 | hypothetical protein | - |
| BB194_RS06415 (BB194_06400) | - | 1209616..1210143 (-) | 528 | WP_017647942.1 | DUF1642 domain-containing protein | - |
| BB194_RS06420 (BB194_06405) | - | 1210147..1210638 (-) | 492 | WP_017285439.1 | hypothetical protein | - |
| BB194_RS06425 (BB194_06410) | - | 1210643..1211128 (-) | 486 | WP_017647943.1 | class I SAM-dependent methyltransferase | - |
| BB194_RS06430 (BB194_06415) | - | 1211131..1211400 (-) | 270 | WP_017647862.1 | hypothetical protein | - |
| BB194_RS06435 (BB194_06420) | - | 1211397..1211561 (-) | 165 | WP_017647863.1 | hypothetical protein | - |
| BB194_RS06440 (BB194_06425) | - | 1211558..1211941 (-) | 384 | WP_017647864.1 | YopX family protein | - |
| BB194_RS11335 | - | 1211938..1212096 (-) | 159 | WP_017647865.1 | hypothetical protein | - |
| BB194_RS06445 (BB194_06430) | - | 1212080..1212376 (-) | 297 | WP_017647866.1 | nucleotide modification associated domain-containing protein | - |
| BB194_RS06450 (BB194_06435) | - | 1212388..1212735 (-) | 348 | WP_017647944.1 | hypothetical protein | - |
| BB194_RS06455 (BB194_06440) | - | 1212725..1213201 (-) | 477 | WP_017647868.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BB194_RS06460 (BB194_06445) | - | 1213191..1213388 (-) | 198 | WP_017647869.1 | hypothetical protein | - |
| BB194_RS06465 (BB194_06450) | - | 1213551..1214348 (-) | 798 | WP_017647870.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| BB194_RS06470 (BB194_06455) | - | 1214345..1215298 (-) | 954 | WP_000064172.1 | RecT family recombinase | - |
| BB194_RS06475 (BB194_06460) | - | 1215299..1215547 (-) | 249 | WP_053515066.1 | hypothetical protein | - |
| BB194_RS06480 (BB194_06465) | - | 1215534..1215809 (-) | 276 | WP_017647873.1 | hypothetical protein | - |
| BB194_RS11340 | - | 1215802..1215945 (-) | 144 | WP_017647874.1 | hypothetical protein | - |
| BB194_RS06485 (BB194_06470) | - | 1215936..1216718 (-) | 783 | WP_000600244.1 | ATP-binding protein | - |
| BB194_RS06490 (BB194_06475) | - | 1216705..1217463 (-) | 759 | WP_000546751.1 | DnaD domain protein | - |
| BB194_RS11345 | - | 1217492..1217635 (-) | 144 | WP_017647875.1 | hypothetical protein | - |
| BB194_RS06495 (BB194_06480) | - | 1217665..1217922 (-) | 258 | WP_001191791.1 | hypothetical protein | - |
| BB194_RS06500 (BB194_06485) | - | 1218051..1218344 (+) | 294 | WP_001104373.1 | hypothetical protein | - |
| BB194_RS11350 | - | 1218341..1218499 (-) | 159 | WP_017647876.1 | hypothetical protein | - |
| BB194_RS06505 (BB194_06490) | - | 1218532..1219260 (-) | 729 | WP_017647877.1 | phage antirepressor KilAC domain-containing protein | - |
| BB194_RS06510 (BB194_06495) | - | 1219308..1219508 (-) | 201 | WP_001875236.1 | helix-turn-helix transcriptional regulator | - |
| BB194_RS06515 (BB194_06500) | - | 1219697..1220056 (+) | 360 | WP_000207087.1 | helix-turn-helix domain-containing protein | - |
| BB194_RS06520 (BB194_06505) | - | 1220046..1220426 (+) | 381 | WP_000686776.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BB194_RS06525 (BB194_06510) | - | 1220479..1220688 (+) | 210 | WP_000520183.1 | TM2 domain-containing protein | - |
| BB194_RS06530 (BB194_06515) | - | 1220865..1221962 (+) | 1098 | WP_000570848.1 | site-specific integrase | - |
| BB194_RS06535 (BB194_06520) | hylB | 1222241..1225459 (+) | 3219 | WP_017647747.1 | hyaluronate lyase | - |
| BB194_RS06540 (BB194_06525) | rfbB | 1225511..1226557 (-) | 1047 | WP_000134282.1 | dTDP-glucose 4,6-dehydratase | - |
| BB194_RS06545 (BB194_06530) | - | 1226764..1227357 (-) | 594 | WP_000139163.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| BB194_RS06550 (BB194_06535) | rfbA | 1227357..1228226 (-) | 870 | WP_000676114.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| BB194_RS06555 (BB194_06540) | - | 1228285..1229388 (-) | 1104 | WP_000716829.1 | FAD-dependent oxidoreductase | - |
| BB194_RS06560 (BB194_06545) | - | 1229397..1230185 (-) | 789 | WP_000647415.1 | Nif3-like dinuclear metal center hexameric protein | - |
| BB194_RS06565 (BB194_06550) | - | 1230175..1230858 (-) | 684 | WP_000365673.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| BB194_RS06570 (BB194_06555) | - | 1230962..1231642 (-) | 681 | WP_000221657.1 | DnaD domain-containing protein | - |
| BB194_RS06575 (BB194_06560) | - | 1231760..1232278 (-) | 519 | WP_000365343.1 | adenine phosphoribosyltransferase | - |
| BB194_RS06580 (BB194_06565) | - | 1232401..1234965 (-) | 2565 | WP_017647748.1 | GBS Bsp-like repeat-containing protein | - |
| BB194_RS06590 (BB194_06575) | recJ | 1235117..1237315 (-) | 2199 | WP_000622242.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6933.00 Da Isoelectric Point: 4.2702
>NTDB_id=233979 BB194_RS06265 WP_017647839.1 1185114..1185296(-) (prx) [Streptococcus agalactiae strain SG-M158]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=233979 BB194_RS06265 WP_017647839.1 1185114..1185296(-) (prx) [Streptococcus agalactiae strain SG-M158]
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |