Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | BB194_RS00900 | Genome accession | NZ_CP021864 |
| Coordinates | 121913..122095 (+) | Length | 60 a.a. |
| NCBI ID | WP_017647839.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain SG-M158 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 81735..124321 | 121913..122095 | within | 0 |
Gene organization within MGE regions
Location: 81735..124321
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BB194_RS00635 (BB194_00635) | - | 81735..82832 (-) | 1098 | WP_000570848.1 | site-specific integrase | - |
| BB194_RS00640 (BB194_00640) | - | 83006..83692 (-) | 687 | WP_053515021.1 | hypothetical protein | - |
| BB194_RS00645 (BB194_00645) | - | 83701..84078 (-) | 378 | WP_053515022.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BB194_RS00650 (BB194_00650) | - | 84062..84403 (-) | 342 | WP_053515023.1 | helix-turn-helix transcriptional regulator | - |
| BB194_RS00655 (BB194_00655) | - | 84599..84811 (+) | 213 | WP_053515024.1 | helix-turn-helix transcriptional regulator | - |
| BB194_RS00660 (BB194_00660) | - | 84840..85565 (+) | 726 | WP_053515025.1 | phage antirepressor KilAC domain-containing protein | - |
| BB194_RS11285 | - | 85598..85756 (+) | 159 | WP_017647876.1 | hypothetical protein | - |
| BB194_RS00665 (BB194_00665) | - | 85753..86046 (-) | 294 | WP_001104373.1 | hypothetical protein | - |
| BB194_RS00670 (BB194_00670) | - | 86175..86432 (+) | 258 | WP_001191791.1 | hypothetical protein | - |
| BB194_RS11290 | - | 86462..86605 (+) | 144 | WP_172798516.1 | hypothetical protein | - |
| BB194_RS00675 (BB194_00675) | - | 86681..86881 (+) | 201 | WP_001058282.1 | hypothetical protein | - |
| BB194_RS00680 (BB194_00680) | - | 86878..87168 (+) | 291 | WP_000650504.1 | hypothetical protein | - |
| BB194_RS00685 (BB194_00685) | - | 87155..87838 (+) | 684 | WP_000704951.1 | AAA family ATPase | - |
| BB194_RS00690 (BB194_00690) | - | 87844..89280 (+) | 1437 | Protein_87 | DEAD/DEAH box helicase | - |
| BB194_RS00695 (BB194_00695) | - | 89293..89775 (+) | 483 | WP_053515027.1 | DUF669 domain-containing protein | - |
| BB194_RS00700 (BB194_00700) | - | 89793..91346 (+) | 1554 | WP_053515028.1 | hypothetical protein | - |
| BB194_RS00705 (BB194_00705) | - | 91591..92457 (+) | 867 | WP_053515029.1 | bifunctional DNA primase/polymerase | - |
| BB194_RS00710 (BB194_00710) | - | 92483..92767 (+) | 285 | WP_053515072.1 | VRR-NUC domain-containing protein | - |
| BB194_RS00715 (BB194_00715) | - | 92846..93142 (+) | 297 | WP_000763916.1 | nucleotide modification associated domain-containing protein | - |
| BB194_RS11295 | - | 93126..93284 (+) | 159 | WP_017646174.1 | hypothetical protein | - |
| BB194_RS00720 (BB194_00720) | - | 93281..93661 (+) | 381 | WP_053515030.1 | YopX family protein | - |
| BB194_RS00725 (BB194_00725) | - | 93658..93822 (+) | 165 | WP_000159367.1 | hypothetical protein | - |
| BB194_RS00730 (BB194_00730) | - | 93819..94088 (+) | 270 | WP_053515031.1 | hypothetical protein | - |
| BB194_RS00735 (BB194_00735) | - | 94090..94440 (+) | 351 | WP_225971866.1 | HNH endonuclease signature motif containing protein | - |
| BB194_RS00740 (BB194_00740) | - | 94444..94926 (+) | 483 | WP_053515033.1 | class I SAM-dependent methyltransferase | - |
| BB194_RS00745 (BB194_00745) | - | 95129..95692 (+) | 564 | WP_053515034.1 | DUF1642 domain-containing protein | - |
| BB194_RS00750 (BB194_00750) | - | 95679..95996 (+) | 318 | WP_053515035.1 | hypothetical protein | - |
| BB194_RS00755 (BB194_00755) | - | 96014..96232 (+) | 219 | WP_053515036.1 | hypothetical protein | - |
| BB194_RS00765 (BB194_00765) | - | 96922..97356 (+) | 435 | WP_000142570.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BB194_RS11300 | - | 97533..97670 (-) | 138 | WP_158472040.1 | hypothetical protein | - |
| BB194_RS00775 (BB194_00775) | - | 98560..98940 (+) | 381 | WP_000090087.1 | hypothetical protein | - |
| BB194_RS00780 (BB194_00780) | - | 98930..100204 (+) | 1275 | WP_000634503.1 | PBSX family phage terminase large subunit | - |
| BB194_RS00785 (BB194_00785) | - | 100204..101529 (+) | 1326 | WP_065367292.1 | phage portal protein | - |
| BB194_RS00790 (BB194_00790) | - | 101498..102424 (+) | 927 | Protein_107 | minor capsid protein | - |
| BB194_RS00795 (BB194_00795) | - | 102558..102884 (+) | 327 | WP_053515038.1 | hypothetical protein | - |
| BB194_RS00800 (BB194_00800) | - | 102998..103567 (+) | 570 | WP_053515039.1 | DUF4355 domain-containing protein | - |
| BB194_RS00805 (BB194_00805) | - | 103586..104476 (+) | 891 | WP_053515040.1 | hypothetical protein | - |
| BB194_RS00810 (BB194_00810) | - | 104489..104782 (+) | 294 | WP_053515041.1 | HeH/LEM domain-containing protein | - |
| BB194_RS00815 (BB194_00815) | - | 104796..105140 (+) | 345 | WP_053515042.1 | hypothetical protein | - |
| BB194_RS00820 (BB194_00820) | - | 105137..105448 (+) | 312 | WP_053515043.1 | hypothetical protein | - |
| BB194_RS00825 (BB194_00825) | - | 105445..105840 (+) | 396 | WP_053515044.1 | hypothetical protein | - |
| BB194_RS00830 (BB194_00830) | - | 105842..106252 (+) | 411 | WP_053515045.1 | DUF5072 family protein | - |
| BB194_RS00835 (BB194_00835) | - | 106264..106770 (+) | 507 | WP_053515046.1 | phage major tail protein, TP901-1 family | - |
| BB194_RS00840 (BB194_00840) | - | 106783..107100 (+) | 318 | WP_053515047.1 | hypothetical protein | - |
| BB194_RS00845 (BB194_00845) | - | 107232..107531 (+) | 300 | WP_235462347.1 | hypothetical protein | - |
| BB194_RS00850 (BB194_00850) | - | 107524..109722 (+) | 2199 | WP_053515049.1 | hypothetical protein | - |
| BB194_RS00855 (BB194_00855) | - | 109733..111241 (+) | 1509 | WP_053515074.1 | distal tail protein Dit | - |
| BB194_RS00860 (BB194_00860) | - | 111232..116199 (+) | 4968 | WP_053515050.1 | glucosaminidase domain-containing protein | - |
| BB194_RS00865 (BB194_00865) | - | 116200..118203 (+) | 2004 | WP_053515051.1 | DUF859 family phage minor structural protein | - |
| BB194_RS00870 (BB194_00870) | - | 118215..118607 (+) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| BB194_RS11510 | - | 118630..118758 (+) | 129 | WP_017647842.1 | hypothetical protein | - |
| BB194_RS00875 (BB194_00875) | - | 118767..119069 (+) | 303 | WP_017647841.1 | hypothetical protein | - |
| BB194_RS00880 (BB194_00880) | - | 119062..119289 (+) | 228 | WP_000609111.1 | phage holin | - |
| BB194_RS00885 (BB194_00885) | - | 119415..120749 (+) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| BB194_RS00890 (BB194_00890) | - | 120893..121144 (-) | 252 | WP_000455662.1 | hypothetical protein | - |
| BB194_RS11305 | - | 121285..121431 (-) | 147 | WP_001030869.1 | hypothetical protein | - |
| BB194_RS00895 (BB194_00895) | - | 121581..121790 (+) | 210 | WP_000424774.1 | helix-turn-helix transcriptional regulator | - |
| BB194_RS00900 (BB194_00900) | prx | 121913..122095 (+) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| BB194_RS00905 (BB194_00905) | - | 122308..123000 (+) | 693 | WP_000049272.1 | histidine phosphatase family protein | - |
| BB194_RS00910 (BB194_00910) | - | 122997..123749 (+) | 753 | WP_000739808.1 | M15 family metallopeptidase | - |
| BB194_RS00915 (BB194_00915) | - | 123746..124321 (+) | 576 | WP_001231504.1 | glucosaminidase domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6933.00 Da Isoelectric Point: 4.2702
>NTDB_id=233942 BB194_RS00900 WP_017647839.1 121913..122095(+) (prx) [Streptococcus agalactiae strain SG-M158]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=233942 BB194_RS00900 WP_017647839.1 121913..122095(+) (prx) [Streptococcus agalactiae strain SG-M158]
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |