Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CDH81_RS10555 | Genome accession | NZ_CP021772 |
| Coordinates | 2003446..2003634 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain B111 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1994699..2003404 | 2003446..2003634 | flank | 42 |
| IS/Tn | 2002400..2003011 | 2003446..2003634 | flank | 435 |
Gene organization within MGE regions
Location: 1994699..2003634
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CDH81_RS10515 (CDH81_10400) | - | 1996078..1996239 (-) | 162 | WP_000508795.1 | NINE protein | - |
| CDH81_RS10520 (CDH81_10405) | - | 1996981..1998258 (+) | 1278 | WP_000594367.1 | ABC transporter permease | - |
| CDH81_RS10525 (CDH81_10410) | - | 1998268..1998924 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| CDH81_RS10530 (CDH81_10415) | - | 1998924..2000300 (+) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| CDH81_RS10535 (CDH81_10420) | - | 2000397..2001050 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| CDH81_RS10540 (CDH81_10425) | - | 2001047..2002348 (+) | 1302 | WP_000734168.1 | HAMP domain-containing sensor histidine kinase | - |
| CDH81_RS10545 (CDH81_10430) | - | 2002400..2003047 (-) | 648 | Protein_1948 | IS3 family transposase | - |
| CDH81_RS10550 (CDH81_10435) | - | 2003225..2003404 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| CDH81_RS10555 (CDH81_10440) | prx | 2003446..2003634 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=233326 CDH81_RS10555 WP_000027835.1 2003446..2003634(+) (prx) [Streptococcus agalactiae strain B111]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=233326 CDH81_RS10555 WP_000027835.1 2003446..2003634(+) (prx) [Streptococcus agalactiae strain B111]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |