Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CDH84_RS02330 | Genome accession | NZ_CP021771 |
| Coordinates | 421544..421732 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain B507 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 412758..421502 | 421544..421732 | flank | 42 |
| IS/Tn | 420477..421088 | 421544..421732 | flank | 456 |
Gene organization within MGE regions
Location: 412758..421732
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CDH84_RS02290 (CDH84_02265) | - | 414137..414298 (-) | 162 | WP_000508795.1 | NINE protein | - |
| CDH84_RS02295 (CDH84_02270) | - | 415040..416317 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| CDH84_RS02300 (CDH84_02275) | - | 416327..416983 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| CDH84_RS02305 (CDH84_02280) | - | 416983..418359 (+) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| CDH84_RS02310 (CDH84_02285) | - | 418456..419109 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| CDH84_RS02315 (CDH84_02290) | - | 419106..420425 (+) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| CDH84_RS02320 (CDH84_02295) | - | 420477..421124 (-) | 648 | Protein_409 | IS3 family transposase | - |
| CDH84_RS02325 (CDH84_02300) | - | 421302..421502 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| CDH84_RS02330 (CDH84_02305) | prx | 421544..421732 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=233245 CDH84_RS02330 WP_000027835.1 421544..421732(+) (prx) [Streptococcus agalactiae strain B507]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=233245 CDH84_RS02330 WP_000027835.1 421544..421732(+) (prx) [Streptococcus agalactiae strain B507]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |