Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CDH83_RS01885 | Genome accession | NZ_CP021770 |
| Coordinates | 334636..334824 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain B508 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 325852..334594 | 334636..334824 | flank | 42 |
| IS/Tn | 333569..334180 | 334636..334824 | flank | 456 |
Gene organization within MGE regions
Location: 325852..334824
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CDH83_RS01845 (CDH83_01810) | - | 327231..327392 (-) | 162 | WP_000508795.1 | NINE protein | - |
| CDH83_RS01850 (CDH83_01815) | - | 328134..329405 (+) | 1272 | WP_112459415.1 | ABC transporter permease | - |
| CDH83_RS01855 (CDH83_01820) | - | 329420..330076 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| CDH83_RS01860 (CDH83_01825) | - | 330076..331452 (+) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| CDH83_RS01865 (CDH83_01830) | - | 331549..332202 (+) | 654 | WP_047198430.1 | response regulator transcription factor | - |
| CDH83_RS01870 (CDH83_01835) | - | 332199..333517 (+) | 1319 | Protein_325 | HAMP domain-containing sensor histidine kinase | - |
| CDH83_RS01875 (CDH83_01840) | - | 333569..334216 (-) | 648 | Protein_326 | IS3 family transposase | - |
| CDH83_RS01880 (CDH83_01845) | - | 334394..334594 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| CDH83_RS01885 (CDH83_01850) | prx | 334636..334824 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=233186 CDH83_RS01885 WP_000027835.1 334636..334824(+) (prx) [Streptococcus agalactiae strain B508]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=233186 CDH83_RS01885 WP_000027835.1 334636..334824(+) (prx) [Streptococcus agalactiae strain B508]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |