Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CDH85_RS10180 | Genome accession | NZ_CP021769 |
| Coordinates | 1941309..1941497 (-) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain B509 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1941953..1950726 | 1941309..1941497 | flank | 456 |
| IS/Tn | 1941953..1942564 | 1941309..1941497 | flank | 456 |
Gene organization within MGE regions
Location: 1941309..1950726
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CDH85_RS10180 (CDH85_10080) | prx | 1941309..1941497 (-) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
| CDH85_RS10185 (CDH85_10085) | - | 1941539..1941739 (-) | 201 | WP_000076708.1 | CsbD family protein | - |
| CDH85_RS10190 (CDH85_10090) | - | 1941917..1942564 (+) | 648 | Protein_1874 | IS3 family transposase | - |
| CDH85_RS10195 (CDH85_10095) | - | 1942616..1943935 (-) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| CDH85_RS10200 (CDH85_10100) | - | 1943932..1944585 (-) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| CDH85_RS10205 (CDH85_10105) | - | 1944682..1946058 (-) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| CDH85_RS10210 (CDH85_10110) | - | 1946058..1946714 (-) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| CDH85_RS10215 (CDH85_10115) | - | 1946724..1948001 (-) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| CDH85_RS10220 (CDH85_10120) | - | 1948743..1948904 (+) | 162 | WP_000508795.1 | NINE protein | - |
| CDH85_RS11065 | - | 1949077..1950439 (-) | 1363 | Protein_1881 | IS3 family transposase | - |
| CDH85_RS10245 (CDH85_10135) | - | 1950460..1950726 (+) | 267 | WP_001872365.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=233174 CDH85_RS10180 WP_000027835.1 1941309..1941497(-) (prx) [Streptococcus agalactiae strain B509]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=233174 CDH85_RS10180 WP_000027835.1 1941309..1941497(-) (prx) [Streptococcus agalactiae strain B509]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |