Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CCX85_RS04915 | Genome accession | NZ_CP021640 |
| Coordinates | 974176..974364 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain JS12 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 966592..1021071 | 974176..974364 | within | 0 |
Gene organization within MGE regions
Location: 966592..1021071
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CCX85_RS04880 (CCX85_04885) | pfkA | 966592..967605 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| CCX85_RS04885 (CCX85_04890) | - | 967685..970795 (-) | 3111 | WP_101248385.1 | DNA polymerase III subunit alpha | - |
| CCX85_RS04890 (CCX85_04895) | - | 970980..971351 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| CCX85_RS04895 (CCX85_04900) | - | 971351..972049 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| CCX85_RS04900 (CCX85_04905) | - | 972059..972844 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| CCX85_RS04905 (CCX85_04910) | - | 972971..973585 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| CCX85_RS04915 (CCX85_04920) | prx | 974176..974364 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| CCX85_RS04920 (CCX85_04925) | spel | 974479..975267 (-) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| CCX85_RS04925 (CCX85_04930) | spem | 975549..976262 (-) | 714 | WP_014635497.1 | streptococcal pyrogenic exotoxin SpeM | - |
| CCX85_RS04930 (CCX85_04935) | - | 976565..977431 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| CCX85_RS04935 (CCX85_04940) | - | 977419..977943 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| CCX85_RS04940 (CCX85_04945) | - | 978099..978740 (-) | 642 | Protein_913 | CHAP domain-containing protein | - |
| CCX85_RS04945 (CCX85_04950) | - | 978853..979545 (-) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| CCX85_RS04950 (CCX85_04955) | - | 979781..980335 (-) | 555 | Protein_915 | glycoside hydrolase family 73 protein | - |
| CCX85_RS04955 (CCX85_04960) | - | 980451..980678 (-) | 228 | WP_002993358.1 | phage holin | - |
| CCX85_RS04960 (CCX85_04965) | - | 980675..980950 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| CCX85_RS04965 (CCX85_04970) | - | 980966..981598 (-) | 633 | WP_030126654.1 | hypothetical protein | - |
| CCX85_RS04970 (CCX85_04975) | - | 981601..982032 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| CCX85_RS04975 (CCX85_04980) | - | 982044..984062 (-) | 2019 | WP_002991755.1 | gp58-like family protein | - |
| CCX85_RS04980 (CCX85_04985) | - | 984078..985187 (-) | 1110 | WP_030126653.1 | hyaluronoglucosaminidase | - |
| CCX85_RS04985 (CCX85_04990) | - | 985187..987298 (-) | 2112 | WP_030126652.1 | phage tail spike protein | - |
| CCX85_RS04990 (CCX85_04995) | - | 987295..988065 (-) | 771 | WP_002992603.1 | distal tail protein Dit | - |
| CCX85_RS04995 (CCX85_05000) | - | 988065..990812 (-) | 2748 | WP_101248387.1 | phage tail tape measure protein | - |
| CCX85_RS05000 (CCX85_05005) | - | 990813..991130 (-) | 318 | WP_002992600.1 | hypothetical protein | - |
| CCX85_RS05005 (CCX85_05010) | - | 991151..991519 (-) | 369 | WP_002992599.1 | tail assembly chaperone | - |
| CCX85_RS05010 (CCX85_05015) | - | 991568..992098 (-) | 531 | WP_002992598.1 | phage major tail protein, TP901-1 family | - |
| CCX85_RS05015 (CCX85_05020) | - | 992086..992484 (-) | 399 | WP_002992597.1 | hypothetical protein | - |
| CCX85_RS05020 (CCX85_05025) | - | 992481..992837 (-) | 357 | WP_002992596.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| CCX85_RS05025 (CCX85_05030) | - | 992837..993133 (-) | 297 | WP_002992595.1 | hypothetical protein | - |
| CCX85_RS05030 (CCX85_05035) | - | 993130..993483 (-) | 354 | WP_002992594.1 | phage head-tail connector protein | - |
| CCX85_RS05035 (CCX85_05040) | - | 993497..993739 (-) | 243 | WP_002992593.1 | HeH/LEM domain-containing protein | - |
| CCX85_RS05040 (CCX85_05045) | - | 993749..994825 (-) | 1077 | WP_002992592.1 | major capsid protein | - |
| CCX85_RS05045 (CCX85_05050) | - | 994825..995229 (-) | 405 | WP_002992591.1 | head decoration protein | - |
| CCX85_RS05050 (CCX85_05055) | - | 995239..995772 (-) | 534 | WP_002992590.1 | DUF4355 domain-containing protein | - |
| CCX85_RS05055 (CCX85_05060) | - | 995915..996181 (-) | 267 | WP_002992589.1 | hypothetical protein | - |
| CCX85_RS05060 (CCX85_05065) | - | 996197..997111 (-) | 915 | WP_002992588.1 | minor capsid protein | - |
| CCX85_RS05065 (CCX85_05070) | - | 997092..998582 (-) | 1491 | WP_002992587.1 | phage portal protein | - |
| CCX85_RS05070 (CCX85_05075) | - | 998594..999838 (-) | 1245 | WP_002992586.1 | PBSX family phage terminase large subunit | - |
| CCX85_RS05075 (CCX85_05080) | - | 999835..1000284 (-) | 450 | WP_033887912.1 | hypothetical protein | - |
| CCX85_RS05080 (CCX85_05085) | - | 1000334..1000711 (-) | 378 | WP_032459833.1 | ASCH domain-containing protein | - |
| CCX85_RS05085 (CCX85_05090) | - | 1000772..1001248 (-) | 477 | WP_181387690.1 | GNAT family N-acetyltransferase | - |
| CCX85_RS05090 (CCX85_05095) | - | 1001164..1001841 (-) | 678 | WP_002995455.1 | ABC transporter ATP-binding protein | - |
| CCX85_RS05095 (CCX85_05100) | - | 1001820..1002338 (-) | 519 | WP_030126646.1 | ParB N-terminal domain-containing protein | - |
| CCX85_RS09155 | - | 1002543..1002776 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| CCX85_RS05105 (CCX85_05110) | - | 1002866..1003780 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| CCX85_RS05115 (CCX85_05120) | - | 1004391..1004831 (-) | 441 | WP_014411867.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CCX85_RS05120 (CCX85_05125) | - | 1005104..1005739 (-) | 636 | WP_030126645.1 | N-6 DNA methylase | - |
| CCX85_RS05125 (CCX85_05130) | - | 1005741..1006025 (-) | 285 | WP_011284869.1 | hypothetical protein | - |
| CCX85_RS09205 | - | 1006022..1006192 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| CCX85_RS05130 (CCX85_05135) | - | 1006189..1006425 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| CCX85_RS09455 (CCX85_05140) | - | 1006425..1006670 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| CCX85_RS05140 (CCX85_05145) | - | 1006667..1007023 (-) | 357 | WP_030126643.1 | hypothetical protein | - |
| CCX85_RS05145 (CCX85_05150) | - | 1007007..1007327 (-) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| CCX85_RS05150 (CCX85_05155) | - | 1007572..1009053 (-) | 1482 | WP_020905118.1 | DNA primase family protein | - |
| CCX85_RS05155 (CCX85_05160) | - | 1009043..1009855 (-) | 813 | WP_030126642.1 | bifunctional DNA primase/polymerase | - |
| CCX85_RS05160 (CCX85_05165) | - | 1009858..1010316 (-) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| CCX85_RS05165 (CCX85_05170) | - | 1010332..1011561 (-) | 1230 | WP_030126641.1 | DEAD/DEAH box helicase | - |
| CCX85_RS05170 (CCX85_05175) | - | 1011663..1012343 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| CCX85_RS05175 (CCX85_05180) | - | 1012344..1012826 (-) | 483 | WP_002995979.1 | siphovirus Gp157 family protein | - |
| CCX85_RS05180 (CCX85_05185) | - | 1013053..1013367 (-) | 315 | WP_002995982.1 | helix-turn-helix transcriptional regulator | - |
| CCX85_RS09410 | - | 1013383..1013517 (-) | 135 | WP_002995985.1 | hypothetical protein | - |
| CCX85_RS05185 (CCX85_05190) | - | 1013514..1013810 (-) | 297 | WP_002995988.1 | MerR family transcriptional regulator | - |
| CCX85_RS05190 (CCX85_05195) | - | 1013888..1014064 (-) | 177 | WP_002995990.1 | helix-turn-helix domain-containing protein | - |
| CCX85_RS05195 (CCX85_05200) | - | 1014208..1014429 (+) | 222 | WP_002992762.1 | hypothetical protein | - |
| CCX85_RS05200 (CCX85_05205) | - | 1014387..1014728 (-) | 342 | WP_030126640.1 | hypothetical protein | - |
| CCX85_RS05205 (CCX85_05210) | - | 1014745..1015164 (-) | 420 | WP_002992766.1 | ORF6C domain-containing protein | - |
| CCX85_RS05210 (CCX85_05215) | - | 1015197..1016120 (-) | 924 | WP_030126638.1 | hypothetical protein | - |
| CCX85_RS05215 (CCX85_05220) | - | 1016149..1016349 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| CCX85_RS05220 (CCX85_05225) | - | 1016443..1016985 (+) | 543 | WP_002992773.1 | hypothetical protein | - |
| CCX85_RS05230 (CCX85_05235) | - | 1017334..1018152 (+) | 819 | WP_030126637.1 | XRE family transcriptional regulator | - |
| CCX85_RS05235 (CCX85_05240) | - | 1018187..1018867 (+) | 681 | WP_002990092.1 | hypothetical protein | - |
| CCX85_RS05240 (CCX85_05245) | - | 1019000..1020088 (+) | 1089 | WP_002984265.1 | site-specific integrase | - |
| CCX85_RS05245 (CCX85_05250) | - | 1020451..1021071 (+) | 621 | WP_101248388.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=232113 CCX85_RS04915 WP_011054546.1 974176..974364(-) (prx) [Streptococcus pyogenes strain JS12]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=232113 CCX85_RS04915 WP_011054546.1 974176..974364(-) (prx) [Streptococcus pyogenes strain JS12]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |