Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPS_RS04915 | Genome accession | NC_004606 |
| Coordinates | 919263..919445 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes SSI-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 878690..919064 | 919263..919445 | flank | 199 |
Gene organization within MGE regions
Location: 878690..919445
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPS_RS04620 (SPs0877) | - | 878690..879778 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| SPS_RS04625 (SPs0878) | - | 879898..880203 (-) | 306 | WP_011106738.1 | membrane protein | - |
| SPS_RS04630 (SPs0879) | - | 880213..881001 (-) | 789 | WP_021340822.1 | LexA family transcriptional regulator | - |
| SPS_RS10310 | - | 881373..881519 (+) | 147 | WP_011054593.1 | hypothetical protein | - |
| SPS_RS04635 (SPs0881) | - | 881653..882432 (-) | 780 | WP_011054591.1 | hypothetical protein | - |
| SPS_RS04640 | - | 882489..882695 (+) | 207 | WP_011054590.1 | hypothetical protein | - |
| SPS_RS04645 (SPs0882) | - | 882684..883070 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| SPS_RS04650 (SPs0883) | - | 883144..883383 (+) | 240 | WP_011054588.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS04660 | - | 883599..883808 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| SPS_RS04665 (SPs0885) | - | 883959..884198 (-) | 240 | WP_011054586.1 | hypothetical protein | - |
| SPS_RS04670 (SPs0886) | - | 884365..884550 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS04675 (SPs0887) | - | 884628..884924 (+) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| SPS_RS10560 | - | 884921..885055 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| SPS_RS04680 (SPs0889) | - | 885071..885385 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| SPS_RS04690 (SPs0890) | - | 885614..886096 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| SPS_RS04695 (SPs0891) | - | 886097..886777 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| SPS_RS04700 (SPs0892) | - | 886879..888108 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| SPS_RS04705 (SPs0893) | - | 888124..888582 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| SPS_RS04710 | - | 888585..889397 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| SPS_RS10690 | - | 889387..889941 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| SPS_RS09870 | - | 889869..890861 (+) | 993 | WP_229309934.1 | phage/plasmid primase, P4 family | - |
| SPS_RS04725 (SPs0899) | - | 891124..891537 (+) | 414 | WP_008087509.1 | hypothetical protein | - |
| SPS_RS04730 (SPs0900) | - | 891534..891854 (+) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| SPS_RS04735 (SPs0901) | - | 891838..892041 (+) | 204 | WP_011054575.1 | hypothetical protein | - |
| SPS_RS04740 (SPs0902) | - | 892038..892322 (+) | 285 | WP_011106747.1 | hypothetical protein | - |
| SPS_RS04745 (SPs0903) | - | 892347..892721 (+) | 375 | WP_011054574.1 | methyltransferase domain-containing protein | - |
| SPS_RS04750 (SPs0904) | - | 892912..893313 (+) | 402 | WP_011054573.1 | DUF7448 domain-containing protein | - |
| SPS_RS04755 (SPs0905) | - | 893313..893948 (+) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| SPS_RS04760 (SPs0906) | - | 894221..894661 (+) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPS_RS04770 (SPs0907) | - | 895247..895585 (+) | 339 | WP_002985375.1 | HNH endonuclease | - |
| SPS_RS04775 (SPs0908) | - | 895757..896224 (+) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| SPS_RS04780 (SPs0909) | - | 896239..897993 (+) | 1755 | WP_011054568.1 | terminase large subunit | - |
| SPS_RS10315 | - | 897990..898160 (+) | 171 | WP_011054567.1 | hypothetical protein | - |
| SPS_RS04785 (SPs0911) | - | 898153..898419 (+) | 267 | WP_011054566.1 | hypothetical protein | - |
| SPS_RS04790 (SPs0912) | - | 898453..899673 (+) | 1221 | WP_011054565.1 | phage portal protein | - |
| SPS_RS04795 (SPs0913) | - | 899651..900316 (+) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| SPS_RS04800 (SPs0914) | - | 900342..901526 (+) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| SPS_RS10565 | - | 901540..901668 (+) | 129 | WP_011054562.1 | hypothetical protein | - |
| SPS_RS04805 (SPs0916) | - | 901671..901973 (+) | 303 | WP_011054561.1 | head-tail connector protein | - |
| SPS_RS04810 (SPs0917) | - | 901970..902308 (+) | 339 | WP_011054560.1 | phage head closure protein | - |
| SPS_RS04815 (SPs0918) | - | 902305..902682 (+) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SPS_RS04820 (SPs0919) | - | 902679..903104 (+) | 426 | WP_011054558.1 | hypothetical protein | - |
| SPS_RS04825 (SPs0920) | - | 903123..903734 (+) | 612 | WP_011054557.1 | major tail protein | - |
| SPS_RS04830 (SPs0921) | gpG | 903787..904113 (+) | 327 | WP_011054556.1 | phage tail assembly chaperone G | - |
| SPS_RS10220 | - | 904161..904310 (+) | 150 | WP_023609816.1 | hypothetical protein | - |
| SPS_RS04840 (SPs0923) | - | 904323..908246 (+) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| SPS_RS04845 (SPs0924) | - | 908246..908953 (+) | 708 | WP_011054553.1 | distal tail protein Dit | - |
| SPS_RS04850 | - | 908950..911097 (+) | 2148 | WP_023605202.1 | phage tail spike protein | - |
| SPS_RS04855 (SPs0927) | - | 911097..912206 (+) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| SPS_RS04860 (SPs0928) | - | 912216..914234 (+) | 2019 | WP_011106754.1 | gp58-like family protein | - |
| SPS_RS04865 | - | 914246..914677 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| SPS_RS04870 | - | 914680..915297 (+) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| SPS_RS04875 (SPs0931) | - | 915307..915582 (+) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| SPS_RS04880 (SPs0932) | - | 915579..915806 (+) | 228 | WP_000609113.1 | phage holin | - |
| SPS_RS04890 (SPs0933) | - | 915922..917130 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| SPS_RS04895 (SPs0934) | - | 917246..917602 (-) | 357 | WP_011054446.1 | hypothetical protein | - |
| SPS_RS04900 (SPs0935) | - | 917660..917899 (-) | 240 | WP_011054447.1 | hypothetical protein | - |
| SPS_RS04905 | - | 918163..918414 (-) | 252 | WP_011054448.1 | hypothetical protein | - |
| SPS_RS10320 | - | 918555..918701 (-) | 147 | WP_011054449.1 | hypothetical protein | - |
| SPS_RS04910 (SPs0937) | - | 918855..919064 (+) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS04915 | prx | 919263..919445 (+) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=22807 SPS_RS04915 WP_029714017.1 919263..919445(+) (prx) [Streptococcus pyogenes SSI-1]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=22807 SPS_RS04915 WP_029714017.1 919263..919445(+) (prx) [Streptococcus pyogenes SSI-1]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |