Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPS_RS04075 | Genome accession | NC_004606 |
| Coordinates | 758959..759141 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes SSI-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 723129..759141 | 758959..759141 | within | 0 |
Gene organization within MGE regions
Location: 723129..759141
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPS_RS03810 (SPs0714) | - | 723147..723989 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| SPS_RS03815 (SPs0715) | - | 723967..724554 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| SPS_RS03820 (SPs0716) | - | 724653..724928 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SPS_RS03825 (SPs0717) | - | 725017..726159 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| SPS_RS03830 (SPs0718) | - | 726283..726801 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SPS_RS03835 (SPs0719) | - | 726813..727568 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS03840 (SPs0720) | - | 727770..727982 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS03845 (SPs0721) | - | 728252..728563 (+) | 312 | WP_010922478.1 | excisionase | - |
| SPS_RS03850 (SPs0722) | - | 728565..728750 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| SPS_RS10420 | - | 728844..729113 (+) | 270 | WP_011106700.1 | replication protein | - |
| SPS_RS03860 (SPs0724) | - | 729254..729640 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| SPS_RS03865 (SPs0725) | - | 729621..729854 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| SPS_RS10285 | - | 729851..729991 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| SPS_RS03870 (SPs0726) | - | 730000..730206 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| SPS_RS03875 | - | 730262..730592 (+) | 331 | Protein_731 | hypothetical protein | - |
| SPS_RS03880 (SPs0729) | - | 730595..731521 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| SPS_RS03885 (SPs0730) | - | 731518..731718 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| SPS_RS03890 (SPs0731) | - | 731711..732508 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SPS_RS03895 (SPs0733) | - | 732873..733268 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| SPS_RS03900 (SPs0734) | - | 733265..734611 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| SPS_RS03905 (SPs0735) | - | 734622..734954 (+) | 333 | WP_011054696.1 | hypothetical protein | - |
| SPS_RS03910 (SPs0736) | - | 734951..735463 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| SPS_RS03915 (SPs0737) | - | 735499..735816 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| SPS_RS10290 | - | 735813..735968 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| SPS_RS03920 (SPs0739) | - | 735965..736216 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| SPS_RS03925 | - | 736292..736711 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| SPS_RS03930 (SPs0741) | - | 736819..737163 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| SPS_RS03935 (SPs0742) | - | 737311..737667 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| SPS_RS03940 (SPs0743) | - | 737664..738932 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| SPS_RS03945 (SPs0744) | - | 738925..740418 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| SPS_RS03950 (SPs0745) | - | 740424..740648 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| SPS_RS10295 | - | 740725..740877 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| SPS_RS03955 (SPs0747) | - | 740870..741136 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| SPS_RS03960 (SPs0748) | - | 741138..741353 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| SPS_RS03965 (SPs0749) | - | 741435..742850 (+) | 1416 | WP_011054685.1 | terminase | - |
| SPS_RS03970 (SPs0750) | - | 742931..743392 (+) | 462 | WP_011054684.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| SPS_RS03975 (SPs0751) | - | 743417..744328 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| SPS_RS03980 (SPs0752) | - | 744328..744528 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| SPS_RS03985 (SPs0753) | - | 744538..744960 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SPS_RS03990 (SPs0754) | - | 744920..745258 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| SPS_RS03995 (SPs0755) | - | 745251..745487 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| SPS_RS04000 (SPs0756) | - | 745488..745823 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| SPS_RS04005 (SPs0757) | - | 745839..746429 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| SPS_RS04010 (SPs0758) | - | 746440..746703 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| SPS_RS04015 (SPs0759) | - | 746718..747089 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| SPS_RS04020 (SPs0760) | - | 747089..749452 (+) | 2364 | WP_011054677.1 | phage tail protein | - |
| SPS_RS04025 (SPs0761) | - | 749449..750144 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| SPS_RS04030 (SPs0762) | - | 750126..752099 (+) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| SPS_RS04035 (SPs0763) | - | 752099..753208 (+) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| SPS_RS04040 (SPs0764) | - | 753223..755004 (+) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| SPS_RS04045 (SPs0765) | - | 755013..755444 (+) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| SPS_RS04050 | - | 755447..756061 (+) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| SPS_RS04055 (SPs0767) | - | 756072..756527 (+) | 456 | WP_002983475.1 | phage holin family protein | - |
| SPS_RS04065 (SPs0769) | - | 756639..757853 (+) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| SPS_RS04070 (SPs0770) | - | 758098..758892 (+) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| SPS_RS04075 (SPs0771) | prx | 758959..759141 (+) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=22804 SPS_RS04075 WP_011054671.1 758959..759141(+) (prx) [Streptococcus pyogenes SSI-1]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=22804 SPS_RS04075 WP_011054671.1 758959..759141(+) (prx) [Streptococcus pyogenes SSI-1]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |