Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPS_RS03065 | Genome accession | NC_004606 |
| Coordinates | 583421..583603 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes SSI-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 545636..583603 | 583421..583603 | within | 0 |
Gene organization within MGE regions
Location: 545636..583603
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPS_RS02790 (SPs0507) | - | 545636..546802 (-) | 1167 | WP_009880742.1 | tyrosine-type recombinase/integrase | - |
| SPS_RS02795 (SPs0509) | - | 546976..547437 (-) | 462 | WP_011106661.1 | hypothetical protein | - |
| SPS_RS10245 | - | 547834..547986 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| SPS_RS02805 (SPs0513) | - | 547997..548374 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPS_RS02810 (SPs0514) | - | 548358..548717 (-) | 360 | WP_011054823.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS02815 (SPs0515) | - | 548906..549124 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS02820 (SPs0516) | - | 549219..549470 (+) | 252 | WP_011054822.1 | helix-turn-helix transcriptional regulator | - |
| SPS_RS10250 | - | 549501..549638 (+) | 138 | WP_011054821.1 | hypothetical protein | - |
| SPS_RS02825 (SPs0518) | - | 549654..549968 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| SPS_RS02835 (SPs0519) | - | 550197..550679 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| SPS_RS02840 (SPs0520) | - | 550680..551360 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| SPS_RS02845 (SPs0521) | - | 551462..552691 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| SPS_RS02850 (SPs0522) | - | 552707..553165 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| SPS_RS02855 (SPs0523) | - | 553168..553980 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| SPS_RS10675 | - | 553970..554524 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| SPS_RS09775 | - | 554452..555450 (+) | 999 | WP_229309620.1 | phage/plasmid primase, P4 family | - |
| SPS_RS02870 (SPs0524) | - | 555695..556015 (+) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| SPS_RS02875 | - | 555999..556355 (+) | 357 | WP_011054816.1 | hypothetical protein | - |
| SPS_RS10620 | - | 556352..556603 (+) | 252 | WP_011106665.1 | hypothetical protein | - |
| SPS_RS02885 (SPs0526) | - | 556597..556881 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| SPS_RS02890 (SPs0527) | - | 556878..557291 (+) | 414 | WP_011054815.1 | YopX family protein | - |
| SPS_RS10255 | - | 557288..557458 (+) | 171 | WP_011054814.1 | hypothetical protein | - |
| SPS_RS02895 | - | 557455..557739 (+) | 285 | WP_032461310.1 | hypothetical protein | - |
| SPS_RS02900 | - | 557742..558077 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| SPS_RS02905 (SPs0530) | - | 558243..558428 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| SPS_RS02910 (SPs0531) | - | 558715..559218 (+) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| SPS_RS10260 | - | 559215..559385 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| SPS_RS02915 (SPs0532) | - | 559669..560103 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPS_RS02920 (SPs0533) | - | 560713..561093 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| SPS_RS09640 | - | 561083..562357 (+) | 1275 | Protein_536 | PBSX family phage terminase large subunit | - |
| SPS_RS02935 (SPs0535) | - | 562357..563682 (+) | 1326 | WP_032461413.1 | phage portal protein | - |
| SPS_RS02940 (SPs0536) | - | 563651..564559 (+) | 909 | WP_009880264.1 | minor capsid protein | - |
| SPS_RS02945 (SPs0537) | - | 564566..564832 (+) | 267 | WP_011054805.1 | hypothetical protein | - |
| SPS_RS02950 (SPs0538) | - | 564982..565554 (+) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| SPS_RS02955 (SPs0539) | - | 565572..566462 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| SPS_RS02960 (SPs0540) | - | 566475..566768 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| SPS_RS02965 (SPs0541) | - | 566782..567126 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| SPS_RS02970 (SPs0542) | - | 567123..567434 (+) | 312 | WP_009880258.1 | hypothetical protein | - |
| SPS_RS02975 (SPs0543) | - | 567431..567826 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| SPS_RS02980 (SPs0544) | - | 567828..568238 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| SPS_RS02985 (SPs0545) | - | 568250..568756 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| SPS_RS02990 (SPs0546) | - | 568769..569086 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| SPS_RS02995 (SPs0547) | - | 569059..569517 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| SPS_RS03000 (SPs0548) | - | 569510..571315 (+) | 1806 | WP_011054802.1 | phage tail protein | - |
| SPS_RS03005 (SPs0549) | - | 571316..572800 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| SPS_RS03010 (SPs0550) | - | 572801..576241 (+) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| SPS_RS03015 (SPs0551) | - | 576246..578108 (+) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| SPS_RS03020 (SPs0552) | - | 578119..578466 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| SPS_RS10550 | - | 578480..578602 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| SPS_RS03030 (SPs0554) | - | 578938..579270 (+) | 333 | WP_011054798.1 | phage holin | - |
| SPS_RS03035 (SPs0555) | - | 579272..580036 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| SPS_RS03040 (SPs0556) | - | 580048..580650 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| SPS_RS03045 (SPs0557) | - | 580661..581434 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| SPS_RS03050 (SPs0558) | - | 581444..581665 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| SPS_RS03055 (SPs0559) | - | 581665..582324 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| SPS_RS03060 (SPs0560) | speA | 582446..583201 (-) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| SPS_RS03065 (SPs0561) | prx | 583421..583603 (+) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=22799 SPS_RS03065 WP_011054793.1 583421..583603(+) (prx) [Streptococcus pyogenes SSI-1]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=22799 SPS_RS03065 WP_011054793.1 583421..583603(+) (prx) [Streptococcus pyogenes SSI-1]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |