Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPS_RS02485 | Genome accession | NC_004606 |
| Coordinates | 485978..486160 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes SSI-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 440562..486160 | 485978..486160 | within | 0 |
Gene organization within MGE regions
Location: 440562..486160
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPS_RS02225 (SPs0403) | fsa | 440562..441206 (+) | 645 | WP_002983569.1 | fructose-6-phosphate aldolase | - |
| SPS_RS02230 (SPs0404) | tkt | 441424..443409 (+) | 1986 | WP_011054904.1 | transketolase | - |
| SPS_RS02235 (SPs0405) | - | 443602..443826 (+) | 225 | WP_011054903.1 | bacteriocin immunity protein | - |
| SPS_RS02240 (SPs0406) | - | 443902..444636 (+) | 735 | WP_011054902.1 | ABC transporter ATP-binding protein | - |
| SPS_RS02245 (SPs0407) | - | 444641..446284 (+) | 1644 | WP_011106629.1 | hypothetical protein | - |
| SPS_RS02250 (SPs0408) | - | 446427..447515 (-) | 1089 | WP_011054900.1 | site-specific integrase | - |
| SPS_RS02255 (SPs0409) | - | 447691..448242 (-) | 552 | WP_011054899.1 | hypothetical protein | - |
| SPS_RS02260 (SPs0410) | - | 448253..448636 (-) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPS_RS02265 (SPs0411) | - | 448650..449000 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| SPS_RS02270 (SPs0412) | - | 449639..449830 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| SPS_RS02275 (SPs0413) | - | 449881..450081 (+) | 201 | WP_011184050.1 | hypothetical protein | - |
| SPS_RS02280 (SPs0414) | - | 450169..450426 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| SPS_RS10230 | - | 450455..450625 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| SPS_RS02285 (SPs0416) | - | 450618..450825 (+) | 208 | Protein_415 | hypothetical protein | - |
| SPS_RS02290 (SPs0417) | - | 450822..451205 (+) | 384 | WP_011054892.1 | hypothetical protein | - |
| SPS_RS02295 (SPs0418) | - | 451351..451554 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| SPS_RS02300 (SPs0419) | - | 451642..451941 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| SPS_RS02305 (SPs0420) | - | 451941..453098 (+) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| SPS_RS02310 (SPs0421) | - | 453112..453675 (+) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| SPS_RS02315 (SPs0422) | - | 453718..455640 (+) | 1923 | WP_011054887.1 | DNA polymerase | - |
| SPS_RS02320 (SPs0423) | - | 455645..458029 (+) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| SPS_RS02325 (SPs0424) | - | 458395..458670 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| SPS_RS02330 (SPs0425) | - | 458667..459989 (+) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| SPS_RS10235 | - | 459990..460160 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| SPS_RS02335 | - | 460153..460425 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| SPS_RS02340 (SPs0428) | - | 460558..460974 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| SPS_RS02345 (SPs0429) | - | 461064..461516 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| SPS_RS02350 (SPs0430) | - | 461506..462783 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| SPS_RS02355 (SPs0431) | - | 462799..464331 (+) | 1533 | WP_011106638.1 | phage portal protein | - |
| SPS_RS02360 (SPs0432) | - | 464291..465739 (+) | 1449 | WP_011054877.1 | minor capsid protein | - |
| SPS_RS02365 | - | 465767..465955 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| SPS_RS02370 (SPs0434) | - | 465960..466226 (+) | 267 | WP_011054875.1 | hypothetical protein | - |
| SPS_RS02375 (SPs0435) | - | 466394..466963 (+) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| SPS_RS02380 (SPs0436) | - | 466976..467863 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| SPS_RS02385 (SPs0437) | - | 467875..468231 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| SPS_RS02390 (SPs0438) | - | 468242..468520 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| SPS_RS02395 (SPs0439) | - | 468517..468861 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SPS_RS02400 (SPs0440) | - | 468865..469224 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| SPS_RS02405 (SPs0441) | - | 469236..469835 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| SPS_RS02410 (SPs0442) | - | 469889..470344 (+) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| SPS_RS02415 (SPs0443) | - | 470419..470652 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| SPS_RS02420 (SPs0444) | - | 470667..475049 (+) | 4383 | WP_011054866.1 | tape measure protein | - |
| SPS_RS02425 (SPs0445) | - | 475061..475903 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| SPS_RS02430 | - | 475913..477892 (+) | 1980 | WP_011054864.1 | phage tail protein | - |
| SPS_RS02435 (SPs0447) | - | 477889..478896 (+) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| SPS_RS02440 | - | 478906..480921 (+) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| SPS_RS02445 (SPs0449) | - | 480933..481370 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| SPS_RS02450 | - | 481367..481984 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| SPS_RS02455 (SPs0451) | - | 481994..482266 (+) | 273 | WP_002986916.1 | DUF7365 family protein | - |
| SPS_RS02460 (SPs0452) | - | 482263..482490 (+) | 228 | WP_003058873.1 | phage holin | - |
| SPS_RS02470 | - | 482606..483808 (+) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| SPS_RS02475 (SPs0454) | - | 484130..484645 (+) | 516 | WP_023077389.1 | hypothetical protein | - |
| SPS_RS02480 (SPs0455) | - | 484759..485745 (-) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| SPS_RS02485 (SPs0456) | prx | 485978..486160 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=22795 SPS_RS02485 WP_011054856.1 485978..486160(+) (prx) [Streptococcus pyogenes SSI-1]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=22795 SPS_RS02485 WP_011054856.1 485978..486160(+) (prx) [Streptococcus pyogenes SSI-1]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |