Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | A6J68_RS04690 | Genome accession | NZ_CP020432 |
| Coordinates | 829724..829912 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus sp. 'group B' strain FDAARGOS_229 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 820938..829682 | 829724..829912 | flank | 42 |
| IS/Tn | 828657..829268 | 829724..829912 | flank | 456 |
Gene organization within MGE regions
Location: 820938..829912
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A6J68_RS04650 (A6J68_04625) | - | 822317..822478 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| A6J68_RS04655 (A6J68_04630) | - | 823220..824497 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| A6J68_RS04660 (A6J68_04635) | - | 824507..825163 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| A6J68_RS04665 (A6J68_04640) | - | 825163..826539 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| A6J68_RS04670 (A6J68_04645) | - | 826636..827289 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| A6J68_RS04675 (A6J68_04650) | - | 827286..828605 (+) | 1320 | WP_000734167.1 | sensor histidine kinase | - |
| A6J68_RS04680 (A6J68_04655) | - | 828657..829304 (-) | 648 | Protein_819 | IS3 family transposase | - |
| A6J68_RS04685 (A6J68_04660) | - | 829482..829682 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| A6J68_RS04690 (A6J68_04665) | prx | 829724..829912 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=222944 A6J68_RS04690 WP_000027835.1 829724..829912(+) (prx) [Streptococcus sp. 'group B' strain FDAARGOS_229]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=222944 A6J68_RS04690 WP_000027835.1 829724..829912(+) (prx) [Streptococcus sp. 'group B' strain FDAARGOS_229]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |