Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | A6J68_RS04415 | Genome accession | NZ_CP020432 |
| Coordinates | 778407..778586 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus sp. 'group B' strain FDAARGOS_229 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 737806..778586 | 778407..778586 | within | 0 |
Gene organization within MGE regions
Location: 737806..778586
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A6J68_RS04150 (A6J68_04145) | - | 737824..738663 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| A6J68_RS04155 (A6J68_04150) | - | 738638..739240 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| A6J68_RS04160 (A6J68_04155) | - | 739343..739618 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| A6J68_RS04165 (A6J68_04160) | - | 739706..740848 (-) | 1143 | WP_000269472.1 | tyrosine-type recombinase/integrase | - |
| A6J68_RS04170 (A6J68_04165) | - | 740963..741514 (-) | 552 | WP_047198696.1 | hypothetical protein | - |
| A6J68_RS04175 (A6J68_04170) | - | 741532..741918 (-) | 387 | WP_000151182.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A6J68_RS04180 (A6J68_04175) | - | 741922..742269 (-) | 348 | WP_000484457.1 | helix-turn-helix domain-containing protein | - |
| A6J68_RS04185 (A6J68_04180) | - | 742565..742810 (+) | 246 | WP_000739596.1 | hypothetical protein | - |
| A6J68_RS04190 (A6J68_04185) | - | 742761..743549 (-) | 789 | WP_000092750.1 | hypothetical protein | - |
| A6J68_RS04195 (A6J68_04190) | - | 743600..743791 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| A6J68_RS04200 (A6J68_04195) | - | 743871..744182 (+) | 312 | WP_001123482.1 | hypothetical protein | - |
| A6J68_RS11470 | - | 744187..744336 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| A6J68_RS04205 (A6J68_04200) | - | 744330..744557 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| A6J68_RS04210 (A6J68_04205) | - | 744550..744780 (+) | 231 | WP_000573547.1 | hypothetical protein | - |
| A6J68_RS04215 (A6J68_04210) | - | 744764..746083 (+) | 1320 | WP_000156426.1 | AAA family ATPase | - |
| A6J68_RS04220 (A6J68_04215) | - | 746098..747171 (+) | 1074 | WP_001167564.1 | ATP-binding protein | - |
| A6J68_RS04225 (A6J68_04220) | - | 747267..747872 (+) | 606 | WP_000141564.1 | hypothetical protein | - |
| A6J68_RS04230 (A6J68_04225) | - | 747872..748480 (+) | 609 | WP_001870729.1 | hypothetical protein | - |
| A6J68_RS04235 (A6J68_04230) | - | 748486..750069 (+) | 1584 | WP_032456395.1 | DEAD/DEAH box helicase | - |
| A6J68_RS04240 (A6J68_04235) | - | 750078..750275 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| A6J68_RS04245 (A6J68_04240) | - | 750268..750519 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| A6J68_RS04250 (A6J68_04245) | - | 750590..752869 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| A6J68_RS04255 (A6J68_04250) | - | 753239..753436 (+) | 198 | WP_000666342.1 | crAss001_48 related protein | - |
| A6J68_RS04260 (A6J68_04255) | - | 753463..753861 (+) | 399 | WP_000151204.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A6J68_RS04265 (A6J68_04260) | - | 753858..754073 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| A6J68_RS04270 (A6J68_04265) | - | 754070..754306 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| A6J68_RS04275 (A6J68_04270) | - | 754303..754533 (+) | 231 | WP_001005355.1 | hypothetical protein | - |
| A6J68_RS04280 (A6J68_04275) | - | 754536..754868 (+) | 333 | WP_000052302.1 | hypothetical protein | - |
| A6J68_RS04285 (A6J68_04280) | - | 754946..755359 (+) | 414 | WP_000041038.1 | transcriptional regulator | - |
| A6J68_RS04290 (A6J68_04285) | - | 755480..755911 (+) | 432 | WP_000041103.1 | terminase small subunit | - |
| A6J68_RS04295 (A6J68_04290) | - | 755901..757181 (+) | 1281 | WP_000208745.1 | PBSX family phage terminase large subunit | - |
| A6J68_RS04300 (A6J68_04295) | - | 757259..758725 (+) | 1467 | WP_370657591.1 | phage portal protein | - |
| A6J68_RS04305 (A6J68_04300) | - | 758685..760133 (+) | 1449 | WP_032459253.1 | phage head morphogenesis protein | - |
| A6J68_RS11715 (A6J68_04305) | - | 760161..760349 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| A6J68_RS04315 (A6J68_04310) | - | 760354..760557 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| A6J68_RS04320 (A6J68_04315) | - | 760700..761269 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| A6J68_RS11475 (A6J68_04320) | - | 761288..762184 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| A6J68_RS04330 (A6J68_04325) | - | 762190..762546 (+) | 357 | WP_000356705.1 | phage head-tail connector protein | - |
| A6J68_RS04335 (A6J68_04330) | - | 762557..762835 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| A6J68_RS04340 (A6J68_04335) | - | 762832..763176 (+) | 345 | WP_000060408.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| A6J68_RS04345 (A6J68_04340) | - | 763180..763539 (+) | 360 | WP_000640604.1 | hypothetical protein | - |
| A6J68_RS04350 (A6J68_04345) | - | 763551..764183 (+) | 633 | WP_000450517.1 | phage major tail protein, TP901-1 family | - |
| A6J68_RS04355 (A6J68_04350) | - | 764234..764689 (+) | 456 | WP_000424190.1 | tail assembly chaperone | - |
| A6J68_RS04360 (A6J68_04355) | - | 764764..764994 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| A6J68_RS04365 (A6J68_04360) | - | 765023..769249 (+) | 4227 | WP_105253162.1 | tape measure protein | - |
| A6J68_RS04370 (A6J68_04365) | - | 769262..770104 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| A6J68_RS04375 (A6J68_04370) | - | 770117..773944 (+) | 3828 | WP_000206522.1 | phage tail protein | - |
| A6J68_RS11480 | - | 773953..774105 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| A6J68_RS04380 (A6J68_04375) | - | 774116..774532 (+) | 417 | WP_001873936.1 | DUF1366 domain-containing protein | - |
| A6J68_RS11485 | - | 774595..774756 (+) | 162 | WP_000222556.1 | hypothetical protein | - |
| A6J68_RS04385 (A6J68_04380) | - | 774766..775062 (+) | 297 | WP_000564987.1 | hypothetical protein | - |
| A6J68_RS04390 (A6J68_04385) | - | 775064..775402 (+) | 339 | WP_001001962.1 | phage holin | - |
| A6J68_RS04395 (A6J68_04390) | - | 775404..776123 (+) | 720 | WP_000236382.1 | peptidoglycan amidohydrolase family protein | - |
| A6J68_RS04400 (A6J68_04395) | - | 776462..777421 (+) | 960 | WP_000829578.1 | Abi family protein | - |
| A6J68_RS04405 (A6J68_04400) | - | 777576..777776 (+) | 201 | WP_000076696.1 | CsbD family protein | - |
| A6J68_RS04410 (A6J68_04405) | - | 777817..777987 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| A6J68_RS11675 | - | 778123..778248 (-) | 126 | WP_017285425.1 | hypothetical protein | - |
| A6J68_RS04415 (A6J68_04410) | prx | 778407..778586 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=222942 A6J68_RS04415 WP_000965651.1 778407..778586(+) (prx) [Streptococcus sp. 'group B' strain FDAARGOS_229]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=222942 A6J68_RS04415 WP_000965651.1 778407..778586(+) (prx) [Streptococcus sp. 'group B' strain FDAARGOS_229]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |