Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | B5D85_RS06165 | Genome accession | NZ_CP020082 |
| Coordinates | 1182958..1183140 (-) | Length | 60 a.a. |
| NCBI ID | WP_032463717.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain STAB120304 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1182958..1225725 | 1182958..1183140 | within | 0 |
Gene organization within MGE regions
Location: 1182958..1225725
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B5D85_RS06165 (B5D85_06145) | prx | 1182958..1183140 (-) | 183 | WP_032463717.1 | hypothetical protein | Regulator |
| B5D85_RS06170 (B5D85_06150) | spel | 1183255..1184043 (-) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| B5D85_RS06175 (B5D85_06155) | spem | 1184325..1185038 (-) | 714 | WP_032463716.1 | streptococcal pyrogenic exotoxin SpeM | - |
| B5D85_RS06180 (B5D85_06160) | - | 1185422..1185982 (-) | 561 | WP_011018106.1 | GNAT family N-acetyltransferase | - |
| B5D85_RS06185 (B5D85_06165) | - | 1186015..1186179 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| B5D85_RS06190 (B5D85_06170) | - | 1186328..1186969 (-) | 642 | Protein_1159 | CHAP domain-containing protein | - |
| B5D85_RS06195 (B5D85_06175) | - | 1187082..1187774 (-) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| B5D85_RS06200 (B5D85_06180) | - | 1188010..1188564 (-) | 555 | Protein_1161 | glycoside hydrolase family 73 protein | - |
| B5D85_RS06205 (B5D85_06185) | - | 1188675..1188860 (-) | 186 | WP_011054731.1 | holin | - |
| B5D85_RS06210 (B5D85_06190) | - | 1188857..1189153 (-) | 297 | WP_023078532.1 | hypothetical protein | - |
| B5D85_RS06215 (B5D85_06195) | - | 1189164..1189796 (-) | 633 | WP_011017396.1 | hypothetical protein | - |
| B5D85_RS06220 (B5D85_06200) | - | 1189799..1190227 (-) | 429 | WP_032463718.1 | DUF1617 family protein | - |
| B5D85_RS06225 (B5D85_06205) | - | 1190239..1192125 (-) | 1887 | WP_076639305.1 | gp58-like family protein | - |
| B5D85_RS06230 (B5D85_06210) | hylP | 1192140..1193153 (-) | 1014 | WP_032463712.1 | hyaluronidase HylP | - |
| B5D85_RS10290 (B5D85_06215) | - | 1193153..1195258 (-) | 2106 | WP_050436577.1 | phage tail spike protein | - |
| B5D85_RS06240 (B5D85_06220) | - | 1195255..1196025 (-) | 771 | WP_030127447.1 | distal tail protein Dit | - |
| B5D85_RS06245 (B5D85_06225) | - | 1196025..1198772 (-) | 2748 | WP_050436576.1 | phage tail tape measure protein | - |
| B5D85_RS06250 (B5D85_06230) | - | 1198772..1199089 (-) | 318 | WP_030127445.1 | hypothetical protein | - |
| B5D85_RS06255 (B5D85_06235) | - | 1199110..1199478 (-) | 369 | WP_030127444.1 | tail assembly chaperone | - |
| B5D85_RS06260 (B5D85_06240) | - | 1199532..1200050 (-) | 519 | WP_030127443.1 | phage major tail protein, TP901-1 family | - |
| B5D85_RS06265 (B5D85_06245) | - | 1200038..1200436 (-) | 399 | WP_030127442.1 | DUF3168 domain-containing protein | - |
| B5D85_RS06270 (B5D85_06250) | - | 1200433..1200789 (-) | 357 | WP_030127441.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| B5D85_RS06275 (B5D85_06255) | - | 1200789..1201085 (-) | 297 | WP_032463711.1 | hypothetical protein | - |
| B5D85_RS06280 (B5D85_06260) | - | 1201082..1201435 (-) | 354 | WP_030127439.1 | phage head-tail connector protein | - |
| B5D85_RS06285 (B5D85_06265) | - | 1201447..1201713 (-) | 267 | WP_030127438.1 | HeH/LEM domain-containing protein | - |
| B5D85_RS06290 (B5D85_06270) | - | 1201725..1202774 (-) | 1050 | WP_030127437.1 | major capsid protein | - |
| B5D85_RS06295 (B5D85_06275) | - | 1202777..1203157 (-) | 381 | WP_002990036.1 | structural protein | - |
| B5D85_RS06300 (B5D85_06280) | - | 1203167..1203700 (-) | 534 | WP_030127436.1 | DUF4355 domain-containing protein | - |
| B5D85_RS06305 (B5D85_06285) | - | 1203844..1204110 (-) | 267 | WP_030127435.1 | hypothetical protein | - |
| B5D85_RS06310 (B5D85_06290) | - | 1204126..1205040 (-) | 915 | WP_032463710.1 | minor capsid protein | - |
| B5D85_RS06315 (B5D85_06295) | - | 1205021..1206511 (-) | 1491 | WP_032461297.1 | phage portal protein | - |
| B5D85_RS06320 (B5D85_06300) | - | 1206523..1207830 (-) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| B5D85_RS06325 (B5D85_06305) | - | 1207808..1208260 (-) | 453 | WP_030127432.1 | terminase small subunit | - |
| B5D85_RS06330 (B5D85_06310) | - | 1208350..1208766 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| B5D85_RS09965 | - | 1208750..1208896 (-) | 147 | WP_023079210.1 | hypothetical protein | - |
| B5D85_RS06335 (B5D85_06315) | - | 1208899..1209171 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| B5D85_RS09970 | - | 1209164..1209334 (-) | 171 | WP_164972002.1 | hypothetical protein | - |
| B5D85_RS06340 (B5D85_06320) | - | 1209335..1210657 (-) | 1323 | WP_030127431.1 | SNF2-related protein | - |
| B5D85_RS06345 (B5D85_06325) | - | 1210654..1210929 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| B5D85_RS06350 (B5D85_06330) | - | 1211315..1213699 (-) | 2385 | WP_032463709.1 | phage/plasmid primase, P4 family | - |
| B5D85_RS06355 (B5D85_06335) | - | 1213704..1215626 (-) | 1923 | WP_030127429.1 | DNA polymerase | - |
| B5D85_RS06360 (B5D85_06340) | - | 1215669..1216232 (-) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| B5D85_RS06365 (B5D85_06345) | - | 1216241..1217398 (-) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| B5D85_RS06370 (B5D85_06350) | - | 1217398..1217697 (-) | 300 | WP_030127427.1 | hypothetical protein | - |
| B5D85_RS06375 (B5D85_06355) | - | 1217785..1217988 (-) | 204 | WP_030127426.1 | hypothetical protein | - |
| B5D85_RS09975 | - | 1217985..1218137 (-) | 153 | WP_017647437.1 | hypothetical protein | - |
| B5D85_RS06380 (B5D85_06360) | - | 1218134..1218520 (-) | 387 | WP_030127425.1 | hypothetical protein | - |
| B5D85_RS06385 (B5D85_06365) | - | 1218517..1218720 (-) | 204 | WP_030127424.1 | hypothetical protein | - |
| B5D85_RS06390 (B5D85_06370) | - | 1218713..1218883 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| B5D85_RS06395 (B5D85_06375) | - | 1218885..1219196 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| B5D85_RS06400 (B5D85_06380) | - | 1219274..1219459 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| B5D85_RS06405 (B5D85_06385) | - | 1219626..1219865 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| B5D85_RS06410 (B5D85_06390) | - | 1220015..1220224 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| B5D85_RS06420 (B5D85_06400) | - | 1220470..1220676 (-) | 207 | WP_001157159.1 | helix-turn-helix domain-containing protein | - |
| B5D85_RS06425 (B5D85_06405) | - | 1220750..1221232 (+) | 483 | WP_021340824.1 | hypothetical protein | - |
| B5D85_RS09980 | - | 1221229..1221375 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| B5D85_RS06430 (B5D85_06410) | - | 1221430..1222029 (+) | 600 | WP_030127422.1 | hypothetical protein | - |
| B5D85_RS06435 (B5D85_06415) | - | 1222060..1222218 (-) | 159 | WP_076636802.1 | hypothetical protein | - |
| B5D85_RS06440 (B5D85_06420) | - | 1222608..1223366 (+) | 759 | WP_030127421.1 | XRE family transcriptional regulator | - |
| B5D85_RS06445 (B5D85_06425) | - | 1223401..1224081 (+) | 681 | WP_030127420.1 | hypothetical protein | - |
| B5D85_RS06450 (B5D85_06430) | - | 1224218..1225360 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| B5D85_RS06455 (B5D85_06435) | - | 1225450..1225725 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6949.84 Da Isoelectric Point: 4.0606
>NTDB_id=220921 B5D85_RS06165 WP_032463717.1 1182958..1183140(-) (prx) [Streptococcus pyogenes strain STAB120304]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=220921 B5D85_RS06165 WP_032463717.1 1182958..1183140(-) (prx) [Streptococcus pyogenes strain STAB120304]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
96.667 |
0.967 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |