Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | B5D85_RS04355 | Genome accession | NZ_CP020082 |
| Coordinates | 805281..805469 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain STAB120304 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 766761..812061 | 805281..805469 | within | 0 |
Gene organization within MGE regions
Location: 766761..812061
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B5D85_RS04090 (B5D85_04085) | - | 766761..767354 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| B5D85_RS04095 (B5D85_04090) | rfbB | 767598..768638 (+) | 1041 | WP_076639686.1 | dTDP-glucose 4,6-dehydratase | - |
| B5D85_RS04100 (B5D85_04095) | - | 768721..769860 (-) | 1140 | WP_011528538.1 | tyrosine-type recombinase/integrase | - |
| B5D85_RS04105 (B5D85_04100) | - | 769982..770668 (-) | 687 | WP_011528539.1 | hypothetical protein | - |
| B5D85_RS09915 | - | 770839..770991 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| B5D85_RS04110 (B5D85_04105) | - | 771002..771379 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| B5D85_RS04115 (B5D85_04110) | - | 771363..771722 (-) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| B5D85_RS04120 (B5D85_04115) | - | 771911..772129 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| B5D85_RS04125 (B5D85_04120) | - | 772224..772475 (+) | 252 | WP_011528542.1 | helix-turn-helix transcriptional regulator | - |
| B5D85_RS10245 | - | 772506..772640 (+) | 135 | WP_011528543.1 | hypothetical protein | - |
| B5D85_RS04130 (B5D85_04125) | - | 772656..772970 (+) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| B5D85_RS04135 (B5D85_04130) | - | 773197..773679 (+) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| B5D85_RS04140 (B5D85_04135) | - | 773680..774360 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| B5D85_RS04145 (B5D85_04140) | - | 774462..775691 (+) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| B5D85_RS04150 (B5D85_04145) | - | 775707..776165 (+) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| B5D85_RS04155 (B5D85_04150) | - | 776168..776980 (+) | 813 | WP_030126642.1 | bifunctional DNA primase/polymerase | - |
| B5D85_RS04160 (B5D85_04155) | - | 776970..778451 (+) | 1482 | WP_020905118.1 | DNA primase family protein | - |
| B5D85_RS04165 (B5D85_04160) | - | 778696..779016 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| B5D85_RS04170 (B5D85_04165) | - | 779000..779356 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| B5D85_RS10275 (B5D85_04170) | - | 779353..779604 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| B5D85_RS04180 (B5D85_04175) | - | 779598..779882 (+) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| B5D85_RS04185 (B5D85_04180) | - | 779879..780148 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| B5D85_RS04190 (B5D85_04185) | - | 780158..780562 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| B5D85_RS09845 | - | 780559..780729 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| B5D85_RS04200 (B5D85_04190) | - | 780726..781232 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| B5D85_RS09920 | - | 781229..781399 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| B5D85_RS10105 | - | 781633..781776 (+) | 144 | Protein_771 | ArpU family transcriptional regulator | - |
| B5D85_RS04210 (B5D85_04195) | - | 781924..782304 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| B5D85_RS04215 (B5D85_04200) | - | 782294..783568 (+) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| B5D85_RS04220 (B5D85_04205) | - | 783568..784893 (+) | 1326 | WP_011528552.1 | phage portal protein | - |
| B5D85_RS04225 (B5D85_04210) | - | 784862..785770 (+) | 909 | WP_011528553.1 | minor capsid protein | - |
| B5D85_RS04230 (B5D85_04215) | - | 785777..786007 (+) | 231 | WP_011528554.1 | hypothetical protein | - |
| B5D85_RS04235 (B5D85_04220) | - | 786119..786688 (+) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| B5D85_RS04240 (B5D85_04225) | - | 786707..787597 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| B5D85_RS04245 (B5D85_04230) | - | 787609..787902 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| B5D85_RS04250 (B5D85_04235) | - | 787916..788260 (+) | 345 | WP_011528558.1 | hypothetical protein | - |
| B5D85_RS04255 (B5D85_04240) | - | 788257..788568 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| B5D85_RS04260 (B5D85_04245) | - | 788565..788960 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| B5D85_RS04265 (B5D85_04250) | - | 788962..789372 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| B5D85_RS04270 (B5D85_04255) | - | 789384..789890 (+) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| B5D85_RS04275 (B5D85_04260) | - | 789903..790220 (+) | 318 | WP_011528563.1 | hypothetical protein | - |
| B5D85_RS04280 (B5D85_04265) | - | 790193..790651 (+) | 459 | WP_011528564.1 | hypothetical protein | - |
| B5D85_RS04285 (B5D85_04270) | - | 790644..792449 (+) | 1806 | WP_011528565.1 | phage tail protein | - |
| B5D85_RS04290 (B5D85_04275) | - | 792450..793934 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| B5D85_RS04295 (B5D85_04280) | - | 793935..797384 (+) | 3450 | WP_050336170.1 | glucosaminidase domain-containing protein | - |
| B5D85_RS04300 (B5D85_04285) | - | 797389..799251 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| B5D85_RS04305 (B5D85_04290) | - | 799262..799609 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| B5D85_RS10250 | - | 799623..799745 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| B5D85_RS04310 (B5D85_04295) | - | 799759..800082 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| B5D85_RS04315 (B5D85_04300) | - | 800082..800414 (+) | 333 | WP_011054798.1 | phage holin | - |
| B5D85_RS04320 (B5D85_04305) | - | 800416..801180 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| B5D85_RS04325 (B5D85_04310) | - | 801192..801794 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| B5D85_RS04330 (B5D85_04315) | - | 801805..802578 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| B5D85_RS04335 (B5D85_04320) | - | 802588..802809 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| B5D85_RS04340 (B5D85_04325) | - | 802809..803468 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| B5D85_RS04345 (B5D85_04330) | - | 803537..803971 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| B5D85_RS04350 (B5D85_04335) | sda3 | 804243..805043 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| B5D85_RS04355 (B5D85_04340) | prx | 805281..805469 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| B5D85_RS04360 (B5D85_04345) | - | 805877..806353 (+) | 477 | WP_002984880.1 | NUDIX hydrolase | - |
| B5D85_RS04365 (B5D85_04350) | - | 806411..807592 (+) | 1182 | WP_038432925.1 | AI-2E family transporter | - |
| B5D85_RS04370 (B5D85_04355) | - | 807582..808829 (+) | 1248 | WP_032460151.1 | tetratricopeptide repeat protein | - |
| B5D85_RS04375 (B5D85_04360) | fbp54 | 808888..810540 (-) | 1653 | WP_076639624.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| B5D85_RS04380 (B5D85_04365) | trpX | 810894..811892 (+) | 999 | WP_076639625.1 | tryptophan ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=220915 B5D85_RS04355 WP_011528571.1 805281..805469(+) (prx) [Streptococcus pyogenes strain STAB120304]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=220915 B5D85_RS04355 WP_011528571.1 805281..805469(+) (prx) [Streptococcus pyogenes strain STAB120304]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |