Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | B4W66_RS05805 | Genome accession | NZ_CP020027 |
| Coordinates | 1138684..1138866 (-) | Length | 60 a.a. |
| NCBI ID | WP_032463717.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain STAB090229 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1138684..1182747 | 1138684..1138866 | within | 0 |
Gene organization within MGE regions
Location: 1138684..1182747
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B4W66_RS05805 (B4W66_05810) | prx | 1138684..1138866 (-) | 183 | WP_032463717.1 | hypothetical protein | Regulator |
| B4W66_RS05810 (B4W66_05815) | spel | 1138981..1139769 (-) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| B4W66_RS05815 (B4W66_05820) | spem | 1140051..1140764 (-) | 714 | WP_032463716.1 | streptococcal pyrogenic exotoxin SpeM | - |
| B4W66_RS05820 (B4W66_05825) | - | 1141148..1141741 (-) | 594 | WP_003051628.1 | GNAT family N-acetyltransferase | - |
| B4W66_RS05825 (B4W66_05830) | - | 1141741..1141905 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| B4W66_RS05830 (B4W66_05835) | - | 1142054..1142695 (-) | 642 | Protein_1096 | CHAP domain-containing protein | - |
| B4W66_RS05835 (B4W66_05840) | - | 1142808..1143500 (-) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| B4W66_RS05840 (B4W66_05845) | - | 1143736..1144290 (-) | 555 | Protein_1098 | glycoside hydrolase family 73 protein | - |
| B4W66_RS05845 (B4W66_05850) | - | 1144401..1144586 (-) | 186 | WP_011054731.1 | holin | - |
| B4W66_RS05850 (B4W66_05855) | - | 1144583..1144879 (-) | 297 | WP_023078532.1 | hypothetical protein | - |
| B4W66_RS05855 (B4W66_05860) | - | 1144890..1145522 (-) | 633 | WP_023611372.1 | hypothetical protein | - |
| B4W66_RS05860 (B4W66_05865) | - | 1145525..1145953 (-) | 429 | WP_032463718.1 | DUF1617 family protein | - |
| B4W66_RS05865 (B4W66_05870) | - | 1145965..1147851 (-) | 1887 | WP_076639305.1 | gp58-like family protein | - |
| B4W66_RS05870 (B4W66_05875) | hylP | 1147866..1148879 (-) | 1014 | WP_032463712.1 | hyaluronidase HylP | - |
| B4W66_RS05875 (B4W66_05880) | - | 1148879..1150756 (-) | 1878 | WP_094751265.1 | phage tail spike protein | - |
| B4W66_RS05880 (B4W66_05885) | - | 1150753..1151523 (-) | 771 | WP_030127447.1 | distal tail protein Dit | - |
| B4W66_RS05885 (B4W66_05890) | - | 1151523..1154270 (-) | 2748 | WP_157727830.1 | phage tail tape measure protein | - |
| B4W66_RS05890 (B4W66_05895) | - | 1154270..1154587 (-) | 318 | WP_030127445.1 | hypothetical protein | - |
| B4W66_RS05895 (B4W66_05900) | - | 1154608..1154976 (-) | 369 | WP_030127444.1 | tail assembly chaperone | - |
| B4W66_RS05900 (B4W66_05905) | - | 1155030..1155548 (-) | 519 | WP_030127443.1 | phage major tail protein, TP901-1 family | - |
| B4W66_RS05905 (B4W66_05910) | - | 1155536..1155934 (-) | 399 | WP_030127442.1 | DUF3168 domain-containing protein | - |
| B4W66_RS05910 (B4W66_05915) | - | 1155931..1156287 (-) | 357 | WP_030127441.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| B4W66_RS05915 (B4W66_05920) | - | 1156287..1156583 (-) | 297 | WP_032463711.1 | hypothetical protein | - |
| B4W66_RS05920 (B4W66_05925) | - | 1156580..1156933 (-) | 354 | WP_030127439.1 | phage head-tail connector protein | - |
| B4W66_RS05925 (B4W66_05930) | - | 1156945..1157211 (-) | 267 | WP_030127438.1 | HeH/LEM domain-containing protein | - |
| B4W66_RS05930 (B4W66_05935) | - | 1157223..1158272 (-) | 1050 | WP_030127437.1 | major capsid protein | - |
| B4W66_RS05935 (B4W66_05940) | - | 1158275..1158655 (-) | 381 | WP_002990036.1 | structural protein | - |
| B4W66_RS05940 (B4W66_05945) | - | 1158665..1159198 (-) | 534 | WP_030127436.1 | DUF4355 domain-containing protein | - |
| B4W66_RS05945 (B4W66_05950) | - | 1159342..1159608 (-) | 267 | WP_030127435.1 | hypothetical protein | - |
| B4W66_RS05950 (B4W66_05955) | - | 1159624..1160538 (-) | 915 | WP_032463710.1 | minor capsid protein | - |
| B4W66_RS05955 (B4W66_05960) | - | 1160519..1162009 (-) | 1491 | WP_032461297.1 | phage portal protein | - |
| B4W66_RS05960 (B4W66_05965) | - | 1162021..1163328 (-) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| B4W66_RS05965 (B4W66_05970) | - | 1163306..1163758 (-) | 453 | WP_030127432.1 | terminase small subunit | - |
| B4W66_RS05970 (B4W66_05975) | - | 1163848..1164264 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| B4W66_RS09565 | - | 1164248..1164394 (-) | 147 | WP_023079210.1 | hypothetical protein | - |
| B4W66_RS05975 (B4W66_05980) | - | 1164397..1164669 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| B4W66_RS09570 | - | 1164662..1164832 (-) | 171 | WP_164972002.1 | hypothetical protein | - |
| B4W66_RS05980 (B4W66_05985) | - | 1164833..1166155 (-) | 1323 | WP_030127431.1 | SNF2-related protein | - |
| B4W66_RS05985 (B4W66_05990) | - | 1166152..1166427 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| B4W66_RS05990 (B4W66_05995) | - | 1166813..1169197 (-) | 2385 | WP_032463709.1 | phage/plasmid primase, P4 family | - |
| B4W66_RS05995 (B4W66_06000) | - | 1169202..1171124 (-) | 1923 | WP_030127429.1 | DNA polymerase | - |
| B4W66_RS06000 (B4W66_06005) | - | 1171167..1171730 (-) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| B4W66_RS06005 (B4W66_06010) | - | 1171739..1172896 (-) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| B4W66_RS06010 (B4W66_06015) | - | 1172896..1173195 (-) | 300 | WP_030127427.1 | hypothetical protein | - |
| B4W66_RS06015 (B4W66_06020) | - | 1173283..1173486 (-) | 204 | WP_030127426.1 | hypothetical protein | - |
| B4W66_RS09575 | - | 1173483..1173635 (-) | 153 | WP_017647437.1 | hypothetical protein | - |
| B4W66_RS06020 (B4W66_06025) | - | 1173632..1174018 (-) | 387 | WP_030127425.1 | hypothetical protein | - |
| B4W66_RS06025 (B4W66_06030) | - | 1174015..1174218 (-) | 204 | WP_030127424.1 | hypothetical protein | - |
| B4W66_RS06030 (B4W66_06035) | - | 1174211..1174381 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| B4W66_RS06035 (B4W66_06040) | - | 1174383..1174694 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| B4W66_RS06040 (B4W66_06045) | - | 1174772..1174957 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| B4W66_RS06045 (B4W66_06050) | - | 1175124..1175363 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| B4W66_RS06050 (B4W66_06055) | - | 1175513..1175722 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| B4W66_RS06060 (B4W66_06065) | - | 1175968..1176174 (-) | 207 | WP_001157159.1 | helix-turn-helix domain-containing protein | - |
| B4W66_RS06065 (B4W66_06070) | - | 1176248..1176730 (+) | 483 | WP_021340824.1 | hypothetical protein | - |
| B4W66_RS09580 | - | 1176727..1176873 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| B4W66_RS06070 (B4W66_06075) | - | 1176928..1177527 (+) | 600 | WP_030127422.1 | hypothetical protein | - |
| B4W66_RS06075 (B4W66_06080) | - | 1177558..1177716 (-) | 159 | WP_076636802.1 | hypothetical protein | - |
| B4W66_RS06080 (B4W66_06085) | - | 1178106..1178864 (+) | 759 | WP_030127421.1 | XRE family transcriptional regulator | - |
| B4W66_RS06085 (B4W66_06090) | - | 1178899..1179579 (+) | 681 | WP_030127420.1 | hypothetical protein | - |
| B4W66_RS06090 (B4W66_06095) | - | 1179716..1180858 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| B4W66_RS06095 (B4W66_06100) | - | 1180948..1181223 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| B4W66_RS06100 (B4W66_06105) | - | 1181322..1181909 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| B4W66_RS06105 (B4W66_06110) | - | 1181887..1182729 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6949.84 Da Isoelectric Point: 4.0606
>NTDB_id=220435 B4W66_RS05805 WP_032463717.1 1138684..1138866(-) (prx) [Streptococcus pyogenes strain STAB090229]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=220435 B4W66_RS05805 WP_032463717.1 1138684..1138866(-) (prx) [Streptococcus pyogenes strain STAB090229]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
96.667 |
0.967 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |