Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | B4W66_RS03995 | Genome accession | NZ_CP020027 |
| Coordinates | 760769..760957 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain STAB090229 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 721912..769349 | 760769..760957 | within | 0 |
Gene organization within MGE regions
Location: 721912..769349
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B4W66_RS03730 (B4W66_03730) | - | 721912..722505 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| B4W66_RS03735 (B4W66_03735) | rfbB | 722749..723789 (+) | 1041 | WP_076639686.1 | dTDP-glucose 4,6-dehydratase | - |
| B4W66_RS03740 (B4W66_03740) | - | 723872..725011 (-) | 1140 | WP_011528538.1 | tyrosine-type recombinase/integrase | - |
| B4W66_RS03745 (B4W66_03745) | - | 725133..725819 (-) | 687 | WP_011528539.1 | hypothetical protein | - |
| B4W66_RS09515 | - | 725990..726142 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| B4W66_RS03750 (B4W66_03750) | - | 726153..726530 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| B4W66_RS03755 (B4W66_03755) | - | 726514..726873 (-) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| B4W66_RS03760 (B4W66_03760) | - | 727062..727280 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| B4W66_RS03765 (B4W66_03765) | - | 727375..727626 (+) | 252 | WP_011528542.1 | helix-turn-helix transcriptional regulator | - |
| B4W66_RS09795 | - | 727657..727791 (+) | 135 | WP_011528543.1 | hypothetical protein | - |
| B4W66_RS03770 (B4W66_03770) | - | 727807..728121 (+) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| B4W66_RS03775 (B4W66_03775) | - | 728348..728830 (+) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| B4W66_RS03780 (B4W66_03780) | - | 728831..729511 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| B4W66_RS03785 (B4W66_03785) | - | 729613..730842 (+) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| B4W66_RS03790 (B4W66_03790) | - | 730858..731316 (+) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| B4W66_RS03795 (B4W66_03795) | - | 731319..732131 (+) | 813 | WP_030126642.1 | bifunctional DNA primase/polymerase | - |
| B4W66_RS03800 (B4W66_03800) | - | 732121..733602 (+) | 1482 | WP_020905118.1 | DNA primase family protein | - |
| B4W66_RS03805 (B4W66_03805) | - | 733847..734167 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| B4W66_RS03810 (B4W66_03810) | - | 734151..734507 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| B4W66_RS09830 (B4W66_03815) | - | 734504..734755 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| B4W66_RS03820 (B4W66_03820) | - | 734749..735033 (+) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| B4W66_RS03825 (B4W66_03825) | - | 735030..735299 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| B4W66_RS03830 (B4W66_03830) | - | 735309..735713 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| B4W66_RS09465 | - | 735710..735880 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| B4W66_RS03840 (B4W66_03835) | - | 735877..736383 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| B4W66_RS09520 | - | 736380..736550 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| B4W66_RS03845 (B4W66_03840) | - | 736824..737264 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| B4W66_RS03850 (B4W66_03845) | - | 737412..737792 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| B4W66_RS03855 (B4W66_03850) | - | 737782..739056 (+) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| B4W66_RS03860 (B4W66_03855) | - | 739056..740381 (+) | 1326 | WP_011528552.1 | phage portal protein | - |
| B4W66_RS03865 (B4W66_03860) | - | 740350..741258 (+) | 909 | WP_011528553.1 | minor capsid protein | - |
| B4W66_RS03870 (B4W66_03865) | - | 741265..741495 (+) | 231 | WP_011528554.1 | hypothetical protein | - |
| B4W66_RS03875 (B4W66_03870) | - | 741607..742176 (+) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| B4W66_RS03880 (B4W66_03875) | - | 742195..743085 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| B4W66_RS03885 (B4W66_03880) | - | 743097..743390 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| B4W66_RS03890 (B4W66_03885) | - | 743404..743748 (+) | 345 | WP_011528558.1 | hypothetical protein | - |
| B4W66_RS03895 (B4W66_03890) | - | 743745..744056 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| B4W66_RS03900 (B4W66_03895) | - | 744053..744448 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| B4W66_RS03905 (B4W66_03900) | - | 744450..744860 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| B4W66_RS03910 (B4W66_03905) | - | 744872..745378 (+) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| B4W66_RS03915 (B4W66_03910) | - | 745391..745708 (+) | 318 | WP_011528563.1 | hypothetical protein | - |
| B4W66_RS03920 (B4W66_03915) | - | 745681..746139 (+) | 459 | WP_011528564.1 | hypothetical protein | - |
| B4W66_RS03925 (B4W66_03920) | - | 746132..747937 (+) | 1806 | WP_011528565.1 | phage tail protein | - |
| B4W66_RS03930 (B4W66_03925) | - | 747938..749422 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| B4W66_RS03935 (B4W66_03930) | - | 749423..752872 (+) | 3450 | WP_050336170.1 | glucosaminidase domain-containing protein | - |
| B4W66_RS03940 (B4W66_03935) | - | 752877..754739 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| B4W66_RS03945 (B4W66_03940) | - | 754750..755097 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| B4W66_RS09800 | - | 755111..755233 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| B4W66_RS03950 (B4W66_03945) | - | 755247..755570 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| B4W66_RS03955 (B4W66_03950) | - | 755570..755902 (+) | 333 | WP_011054798.1 | phage holin | - |
| B4W66_RS03960 (B4W66_03955) | - | 755904..756668 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| B4W66_RS03965 (B4W66_03960) | - | 756680..757282 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| B4W66_RS03970 (B4W66_03965) | - | 757293..758066 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| B4W66_RS03975 (B4W66_03970) | - | 758076..758297 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| B4W66_RS03980 (B4W66_03975) | - | 758297..758956 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| B4W66_RS03985 (B4W66_03980) | - | 759025..759459 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| B4W66_RS03990 (B4W66_03985) | sda3 | 759731..760531 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| B4W66_RS03995 (B4W66_03990) | prx | 760769..760957 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| B4W66_RS04000 (B4W66_03995) | - | 761365..761841 (+) | 477 | WP_002984880.1 | NUDIX hydrolase | - |
| B4W66_RS04005 (B4W66_04000) | - | 761899..763080 (+) | 1182 | WP_038432925.1 | AI-2E family transporter | - |
| B4W66_RS04010 (B4W66_04005) | - | 763070..764317 (+) | 1248 | WP_032460151.1 | tetratricopeptide repeat protein | - |
| B4W66_RS04015 (B4W66_04010) | fbp54 | 764376..766028 (-) | 1653 | WP_076639624.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| B4W66_RS04020 (B4W66_04015) | trpX | 766382..767380 (+) | 999 | WP_076639625.1 | tryptophan ABC transporter substrate-binding protein | - |
| B4W66_RS04030 (B4W66_04025) | - | 767725..768594 (+) | 870 | WP_002991975.1 | ABC transporter permease | - |
| B4W66_RS04035 (B4W66_04030) | - | 768591..769349 (+) | 759 | WP_009880825.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=220429 B4W66_RS03995 WP_011528571.1 760769..760957(+) (prx) [Streptococcus pyogenes strain STAB090229]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=220429 B4W66_RS03995 WP_011528571.1 760769..760957(+) (prx) [Streptococcus pyogenes strain STAB090229]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |