Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | BWQ98_RS10970 | Genome accession | NZ_CP019299 |
| Coordinates | 2034842..2034967 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain HKU1-14 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2029842..2039967
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWQ98_RS11745 (BWQ98_10965) | - | 2030181..2031834 (-) | 1654 | Protein_2029 | YhgE/Pip domain-containing protein | - |
| BWQ98_RS10945 (BWQ98_10970) | - | 2031962..2032504 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| BWQ98_RS10960 (BWQ98_10985) | comE | 2032747..2033499 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| BWQ98_RS10965 (BWQ98_10990) | comD/comD1 | 2033496..2034821 (-) | 1326 | WP_127245098.1 | competence system sensor histidine kinase ComD | Regulator |
| BWQ98_RS10970 (BWQ98_10995) | comC/comC1 | 2034842..2034967 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| BWQ98_RS10980 (BWQ98_11005) | rlmH | 2035250..2035729 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| BWQ98_RS10985 (BWQ98_11010) | htrA | 2035912..2037093 (+) | 1182 | WP_000681597.1 | trypsin-like peptidase domain-containing protein | Regulator |
| BWQ98_RS10990 (BWQ98_11015) | spo0J | 2037151..2037909 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=214737 BWQ98_RS10970 WP_000799689.1 2034842..2034967(-) (comC/comC1) [Streptococcus pneumoniae strain HKU1-14]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=214737 BWQ98_RS10970 WP_000799689.1 2034842..2034967(-) (comC/comC1) [Streptococcus pneumoniae strain HKU1-14]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GCTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GCTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |