Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPY_RS05940 | Genome accession | NC_002737 |
| Coordinates | 1189309..1189491 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes M1 GAS | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1189309..1224431 | 1189309..1189491 | within | 0 |
Gene organization within MGE regions
Location: 1189309..1224431
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPY_RS05940 | prx | 1189309..1189491 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| SPY_RS05945 (SPy1436) | sda3 | 1189729..1190529 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| SPY_RS05950 (SPy1437) | - | 1190800..1191234 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| SPY_RS05955 (SPy1438) | - | 1191304..1192509 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| SPY_RS05960 (SPy1440) | - | 1192625..1192852 (-) | 228 | WP_003058873.1 | phage holin | - |
| SPY_RS05965 (SPy1441) | - | 1192849..1193124 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| SPY_RS05970 (SPy1442) | - | 1193134..1193751 (-) | 618 | WP_010922447.1 | DUF1366 domain-containing protein | - |
| SPY_RS05975 (SPy1443) | - | 1193754..1194185 (-) | 432 | WP_010922448.1 | DUF1617 family protein | - |
| SPY_RS05980 (SPy1444) | - | 1194197..1195981 (-) | 1785 | WP_010922449.1 | gp58-like family protein | - |
| SPY_RS05985 (SPy1445) | hylP | 1195996..1197108 (-) | 1113 | WP_010922450.1 | hyaluronoglucosaminidase | - |
| SPY_RS05990 (SPy1446) | - | 1197108..1199066 (-) | 1959 | WP_010922451.1 | phage tail spike protein | - |
| SPY_RS05995 (SPy1447) | - | 1199063..1199758 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| SPY_RS06000 (SPy1448) | - | 1199755..1202112 (-) | 2358 | WP_010922453.1 | phage tail protein | - |
| SPY_RS06005 (SPy1449) | - | 1202112..1202483 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| SPY_RS06010 (SPy1450) | - | 1202498..1202761 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| SPY_RS06015 (SPy1451) | - | 1202772..1203365 (-) | 594 | WP_010922456.1 | tail protein | - |
| SPY_RS06020 (SPy1452) | - | 1203377..1203712 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| SPY_RS06025 (SPy1453) | - | 1203713..1203949 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| SPY_RS06030 (SPy1454) | - | 1203942..1204280 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| SPY_RS06035 (SPy1455) | - | 1204240..1204662 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SPY_RS06040 (SPy1456) | - | 1204672..1204872 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| SPY_RS06045 (SPy1457) | - | 1204872..1205783 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| SPY_RS06050 (SPy1459) | - | 1205808..1206269 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| SPY_RS06055 (SPy1460) | - | 1206350..1207765 (-) | 1416 | WP_011285619.1 | terminase | - |
| SPY_RS06060 (SPy1461) | - | 1207875..1208141 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| SPY_RS06065 (SPy1462) | - | 1208134..1208313 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| SPY_RS06070 (SPy1463) | - | 1208363..1208587 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| SPY_RS06075 (SPy1464) | - | 1208593..1210086 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| SPY_RS06080 (SPy1465) | - | 1210079..1211347 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| SPY_RS06085 (SPy1466) | - | 1211344..1211700 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| SPY_RS06090 (SPy1468) | - | 1211849..1212193 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| SPY_RS06095 (SPy1469) | - | 1212302..1212721 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| SPY_RS06100 (SPy1470) | - | 1212989..1213624 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| SPY_RS06105 (SPy1471) | - | 1213626..1213895 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| SPY_RS06110 (SPy1473) | - | 1213979..1214491 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| SPY_RS06115 (SPy1474) | - | 1214488..1214829 (-) | 342 | WP_030127594.1 | hypothetical protein | - |
| SPY_RS06120 (SPy1475) | - | 1215006..1215803 (-) | 798 | WP_010922472.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SPY_RS06125 (SPy1476) | - | 1215796..1215996 (-) | 201 | WP_010922473.1 | hypothetical protein | - |
| SPY_RS06130 (SPy1477) | - | 1215993..1216982 (-) | 990 | WP_010922474.1 | recombinase RecT | - |
| SPY_RS06135 (SPy1478) | - | 1216982..1217314 (-) | 333 | WP_010922475.1 | hypothetical protein | - |
| SPY_RS06140 (SPy1479) | - | 1217370..1217576 (-) | 207 | WP_010922476.1 | hypothetical protein | - |
| SPY_RS09240 | - | 1217585..1217725 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| SPY_RS06145 (SPy1481) | - | 1217722..1217955 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| SPY_RS06150 (SPy1482) | - | 1217936..1218322 (-) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| SPY_RS09410 (SPy1482a) | - | 1218448..1218717 (-) | 270 | WP_011106700.1 | replication protein | - |
| SPY_RS06155 (SPy1483) | - | 1218811..1218996 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| SPY_RS06160 (SPy1484) | - | 1218998..1219309 (-) | 312 | WP_010922478.1 | excisionase | - |
| SPY_RS06165 (SPy1485) | - | 1219579..1219791 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| SPY_RS06170 (SPy1486) | - | 1219993..1220748 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| SPY_RS06175 (SPy1487) | - | 1220760..1221278 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SPY_RS06180 (SPy1488) | - | 1221402..1222544 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| SPY_RS06185 (SPy1489) | - | 1222632..1222907 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SPY_RS06190 (SPy1491) | - | 1223006..1223593 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| SPY_RS06195 (SPy1492) | - | 1223571..1224413 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=20884 SPY_RS05940 WP_011017964.1 1189309..1189491(-) (prx) [Streptococcus pyogenes M1 GAS]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=20884 SPY_RS05940 WP_011017964.1 1189309..1189491(-) (prx) [Streptococcus pyogenes M1 GAS]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |