Detailed information    

insolico Bioinformatically predicted

Overview

Name   prx   Type   Regulator
Locus tag   Spy49_1454c Genome accession   CP000829
Coordinates   1461245..1461424 (-) Length   59 a.a.
NCBI ID   ACI61726.1    Uniprot ID   -
Organism   Streptococcus pyogenes NZ131     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1460135..1508534 1461245..1461424 within 0


Gene organization within MGE regions


Location: 1460135..1508534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Spy49_1452c - 1460135..1460356 (-) 222 ACI61724.1 Conserved hypothetical protein -
  Spy49_1453 - 1460526..1460900 (+) 375 ACI61725.1 Putative repressor-phage associated -
  Spy49_1454c prx 1461245..1461424 (-) 180 ACI61726.1 Paratox Regulator
  Spy49_1455 spd3 1461662..1462462 (+) 801 ACI61727.1 Streptodornase -
  Spy49_1456 - 1462842..1463168 (+) 327 ACI61728.1 hypothetical protein -
  Spy49_1457c - 1463218..1464084 (-) 867 ACI61729.1 hypothetical protein-phage associated -
  Spy49_1458c - 1464072..1464596 (-) 525 ACI61730.1 Uncharacterized phage-associated protein -
  Spy49_1459c - 1464736..1465944 (-) 1209 ACI61731.1 Phage-associated cell wall hydrolase -
  Spy49_1460c - 1466060..1466287 (-) 228 ACI61732.1 Holin -
  Spy49_1461c - 1466284..1466559 (-) 276 ACI61733.1 hypothetical protein -
  Spy49_1462c - 1466569..1467186 (-) 618 ACI61734.1 hypothetical protein -
  Spy49_1463c - 1467189..1467350 (-) 162 ACI61735.1 hypothetical protein -
  Spy49_1464c - 1467364..1469274 (-) 1911 ACI61736.1 Hypothetical p protein -
  Spy49_1465c - 1469290..1470294 (-) 1005 ACI61737.1 Hyaluronidase-phage associated -
  Spy49_1466c - 1470291..1472342 (-) 2052 ACI61738.1 hypothetical protein -
  Spy49_1467c - 1472339..1473118 (-) 780 ACI61739.1 Phage associated hypothetical protein -
  Spy49_1468c - 1473151..1476786 (-) 3636 ACI61740.1 Putative minor tail protein -
  Spy49_1470c - 1476801..1477130 (-) 330 ACI61741.1 hypothetical protein -
  Spy49_1471c - 1477172..1477531 (-) 360 ACI61742.1 hypothetical protein -
  Spy49_1472c - 1477584..1478237 (-) 654 ACI61743.1 Major tail protein -
  Spy49_1474c - 1478247..1478636 (-) 390 ACI61744.1 Structural protein -
  Spy49_1475c - 1478633..1478989 (-) 357 ACI61745.1 Hypothetical p protein -
  Spy49_1476c - 1478979..1479287 (-) 309 ACI61746.1 hypothetical protein-phage 370.2 -
  Spy49_1477c - 1479284..1479637 (-) 354 ACI61747.1 hypothetical protein -
  Spy49_1478c - 1479651..1479893 (-) 243 ACI61748.1 hypothetical protein -
  Spy49_1479c - 1479903..1480985 (-) 1083 ACI61749.1 Phage protein -
  Spy49_1480c - 1480988..1481368 (-) 381 ACI61750.1 Putative structural protein-phage associated -
  Spy49_1481c - 1481378..1481911 (-) 534 ACI61751.1 hypothetical protein -
  Spy49_1482c - 1482055..1482321 (-) 267 ACI61752.1 hypothetical protein-phage associated -
  Spy49_1483c - 1482324..1482638 (-) 315 ACI61753.1 hypothetical protein -
  Spy49_1484c - 1482708..1482893 (-) 186 ACI61754.1 hypothetical protein -
  Spy49_1485c - 1482897..1484459 (-) 1563 ACI61755.1 hypothetical protein -
  Spy49_1486c - 1484440..1485942 (-) 1503 ACI61756.1 hypothetical protein -
  Spy49_1487c - 1485954..1487243 (-) 1290 ACI61757.1 Large terminase -
  Spy49_1488c - 1487221..1487703 (-) 483 ACI61758.1 Small terminase -
  Spy49_1489c - 1488535..1488975 (-) 441 ACI61759.1 hypothetical protein -
  Spy49_1491c - 1489415..1489936 (-) 522 ACI61760.1 Hypothetical phage associated protein SpyM3_1331 -
  Spy49_1492c - 1489933..1490226 (-) 294 ACI61761.1 hypothetical protein -
  Spy49_1493c - 1490223..1490408 (-) 186 ACI61762.1 hypothetical protein-phage associated -
  Spy49_1494c - 1490506..1490991 (-) 486 ACI61763.1 DNA N-4 cytosine methyltransferase M.NgoMXV -
  Spy49_1496c - 1491276..1491680 (-) 405 ACI61764.1 Hypothetical phage associated protein SpyM3_1243 -
  Spy49_1497c - 1491664..1491954 (-) 291 ACI61765.1 hypothetical protein -
  Spy49_1498c - 1492193..1492549 (-) 357 ACI61766.1 hypothetical protein-phage associated -
  Spy49_1499c - 1492625..1492987 (-) 363 ACI61767.1 hypothetical protein -
  Spy49_1500c ssb 1493196..1493621 (-) 426 ACI61768.1 Single-strand binding protein 3 Machinery gene
  Spy49_1501c - 1493614..1494288 (-) 675 ACI61769.1 Recombination protein -
  Spy49_1502c - 1494289..1494435 (-) 147 ACI61770.1 hypothetical protein -
  Spy49_1504c - 1494793..1495047 (-) 255 ACI61771.1 hypothetical protein -
  Spy49_1505c - 1495034..1495381 (-) 348 ACI61772.1 hypothetical protein -
  Spy49_1506c - 1495522..1497093 (-) 1572 ACI61773.1 DNA replication protein dnaC -
  Spy49_1507c - 1497209..1497652 (-) 444 ACI61774.1 hypothetical protein -
  Spy49_1509c - 1498078..1498350 (-) 273 ACI61775.1 hypothetical protein -
  Spy49_1510c - 1498523..1498702 (-) 180 ACI61776.1 hypothetical protein -
  Spy49_1511c - 1498833..1498967 (-) 135 ACI61777.1 hypothetical protein-phage associated -
  Spy49_1512c - 1499249..1499608 (-) 360 ACI61778.1 hypothetical protein -
  Spy49_1513c - 1499682..1499939 (-) 258 ACI61779.1 hypothetical protein -
  Spy49_1514c - 1500142..1500483 (-) 342 ACI61780.1 hypothetical protein -
  Spy49_1516c - 1500755..1500904 (-) 150 ACI61781.1 hypothetical protein-phage associated -
  Spy49_1517c - 1500936..1501664 (-) 729 ACI61782.1 Putative P1-type antirepressor-phage associated -
  Spy49_1518c - 1501697..1501885 (-) 189 ACI61783.1 Putative cro protein -
  Spy49_1520c - 1502073..1502255 (-) 183 ACI61784.1 hypothetical protein -
  Spy49_1521c - 1502532..1503293 (-) 762 ACI61785.1 Antirepressor -
  Spy49_1522 - 1503460..1503732 (+) 273 ACI61786.1 hypothetical protein -
  Spy49_1525 - 1504006..1504473 (+) 468 ACI61787.1 hypothetical protein -
  Spy49_1526 - 1504589..1505368 (+) 780 ACI61788.1 hypothetical protein -
  Spy49_1528c - 1505502..1505660 (-) 159 ACI61789.1 hypothetical protein -
  Spy49_1529 - 1506024..1506782 (+) 759 ACI61790.1 Repressor protein -
  Spy49_1530 - 1506855..1507277 (+) 423 ACI61791.1 Lj965 prophage superinfection immunity protein -
  Spy49_1531 - 1507398..1508534 (+) 1137 ACI61792.1 Prophage NZ131.3 probable integrase -

Sequence

Protein


Download         Length: 59 a.a.        Molecular weight: 6806.93 Da        Isoelectric Point: 4.2331

>NTDB_id=20161 Spy49_1454c ACI61726.1 1461245..1461424(-) (prx) [Streptococcus pyogenes NZ131]
MLTYDEFKQAIDKGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVLMELR

Nucleotide


Download         Length: 180 bp        

>NTDB_id=20161 Spy49_1454c ACI61726.1 1461245..1461424(-) (prx) [Streptococcus pyogenes NZ131]
ATGCTAACATACGACGAGTTTAAACAAGCAATTGACAAGGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGCTAATGGAATTGAGGTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

75.862

98.305

0.746
  prx Streptococcus pyogenes MGAS315

75.862

98.305

0.746
  prx Streptococcus pyogenes MGAS315

72.414

98.305

0.712
  prx Streptococcus pyogenes MGAS8232

72.414

98.305

0.712
  prx Streptococcus pyogenes MGAS315

88.095

71.186

0.627
  prx Streptococcus pyogenes MGAS315

85.366

69.492

0.593
  prx Streptococcus pyogenes MGAS315

78.049

69.492

0.542

Multiple sequence alignment