Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | A9256_RS00890 | Genome accession | NZ_CP016391 |
| Coordinates | 135597..135779 (+) | Length | 60 a.a. |
| NCBI ID | WP_017647839.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain FWL1402 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 95419..138005 | 135597..135779 | within | 0 |
Gene organization within MGE regions
Location: 95419..138005
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9256_RS00635 (A9256_00635) | - | 95419..96516 (-) | 1098 | WP_000570848.1 | site-specific integrase | - |
| A9256_RS11575 | - | 97137..97376 (-) | 240 | Protein_90 | hypothetical protein | - |
| A9256_RS00645 (A9256_00645) | - | 97385..97762 (-) | 378 | WP_053515022.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A9256_RS00650 (A9256_00650) | - | 97746..98087 (-) | 342 | WP_053515023.1 | helix-turn-helix domain-containing protein | - |
| A9256_RS00655 (A9256_00655) | - | 98283..98495 (+) | 213 | WP_053515024.1 | helix-turn-helix transcriptional regulator | - |
| A9256_RS00660 (A9256_00660) | - | 98524..99249 (+) | 726 | WP_053515025.1 | phage antirepressor KilAC domain-containing protein | - |
| A9256_RS11280 | - | 99282..99440 (+) | 159 | WP_017647876.1 | hypothetical protein | - |
| A9256_RS00665 (A9256_00665) | - | 99437..99730 (-) | 294 | WP_001104373.1 | hypothetical protein | - |
| A9256_RS00670 (A9256_00670) | - | 99859..100116 (+) | 258 | WP_001191791.1 | hypothetical protein | - |
| A9256_RS11285 | - | 100146..100289 (+) | 144 | WP_172798516.1 | hypothetical protein | - |
| A9256_RS00675 (A9256_00675) | - | 100365..100565 (+) | 201 | WP_001058282.1 | hypothetical protein | - |
| A9256_RS00680 (A9256_00680) | - | 100562..100852 (+) | 291 | WP_000650504.1 | hypothetical protein | - |
| A9256_RS00685 (A9256_00685) | - | 100839..101522 (+) | 684 | WP_000704951.1 | AAA family ATPase | - |
| A9256_RS00690 (A9256_00690) | - | 101579..102964 (+) | 1386 | WP_235462353.1 | DEAD/DEAH box helicase | - |
| A9256_RS00695 (A9256_00695) | - | 102977..103459 (+) | 483 | WP_053515027.1 | DUF669 domain-containing protein | - |
| A9256_RS00700 (A9256_00700) | - | 103477..105030 (+) | 1554 | WP_053515028.1 | hypothetical protein | - |
| A9256_RS00705 (A9256_00705) | - | 105275..106141 (+) | 867 | WP_053515029.1 | bifunctional DNA primase/polymerase | - |
| A9256_RS00710 (A9256_00710) | - | 106167..106451 (+) | 285 | WP_053515072.1 | VRR-NUC domain-containing protein | - |
| A9256_RS00715 (A9256_00715) | - | 106530..106826 (+) | 297 | WP_000763916.1 | nucleotide modification associated domain-containing protein | - |
| A9256_RS11290 | - | 106810..106968 (+) | 159 | WP_017646174.1 | hypothetical protein | - |
| A9256_RS00720 (A9256_00720) | - | 106965..107345 (+) | 381 | WP_053515030.1 | YopX family protein | - |
| A9256_RS10645 | - | 107342..107506 (+) | 165 | WP_000159367.1 | hypothetical protein | - |
| A9256_RS00725 (A9256_00725) | - | 107503..107772 (+) | 270 | WP_053515031.1 | hypothetical protein | - |
| A9256_RS00730 (A9256_00730) | - | 107774..108124 (+) | 351 | WP_225971866.1 | HNH endonuclease | - |
| A9256_RS00735 (A9256_00735) | - | 108128..108610 (+) | 483 | WP_053515033.1 | class I SAM-dependent methyltransferase | - |
| A9256_RS00740 (A9256_00740) | - | 108813..109376 (+) | 564 | WP_053515034.1 | DUF1642 domain-containing protein | - |
| A9256_RS00745 (A9256_00745) | - | 109363..109680 (+) | 318 | WP_053515035.1 | hypothetical protein | - |
| A9256_RS00750 (A9256_00750) | - | 109698..109916 (+) | 219 | WP_053515036.1 | hypothetical protein | - |
| A9256_RS00755 (A9256_00755) | - | 110606..111040 (+) | 435 | WP_000142570.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| A9256_RS00765 (A9256_00765) | - | 112244..112624 (+) | 381 | WP_000090087.1 | hypothetical protein | - |
| A9256_RS00770 (A9256_00770) | - | 112614..113888 (+) | 1275 | WP_000634503.1 | PBSX family phage terminase large subunit | - |
| A9256_RS00775 (A9256_00775) | - | 113888..115213 (+) | 1326 | WP_065367292.1 | phage portal protein | - |
| A9256_RS00780 (A9256_00780) | - | 115182..116108 (+) | 927 | WP_061811549.1 | minor capsid protein | - |
| A9256_RS00785 (A9256_00785) | - | 116242..116568 (+) | 327 | WP_053515038.1 | hypothetical protein | - |
| A9256_RS00790 (A9256_00790) | - | 116682..117251 (+) | 570 | WP_053515039.1 | DUF4355 domain-containing protein | - |
| A9256_RS00795 (A9256_00795) | - | 117270..118160 (+) | 891 | WP_053515040.1 | hypothetical protein | - |
| A9256_RS00800 (A9256_00800) | - | 118173..118466 (+) | 294 | WP_053515041.1 | HeH/LEM domain-containing protein | - |
| A9256_RS00805 (A9256_00805) | - | 118480..118824 (+) | 345 | WP_053515042.1 | hypothetical protein | - |
| A9256_RS00810 (A9256_00810) | - | 118821..119132 (+) | 312 | WP_053515043.1 | hypothetical protein | - |
| A9256_RS00815 (A9256_00815) | - | 119129..119524 (+) | 396 | WP_053515044.1 | hypothetical protein | - |
| A9256_RS00820 (A9256_00820) | - | 119526..119936 (+) | 411 | WP_053515045.1 | DUF5072 family protein | - |
| A9256_RS00825 (A9256_00825) | - | 119948..120454 (+) | 507 | WP_053515046.1 | phage major tail protein, TP901-1 family | - |
| A9256_RS00830 (A9256_00830) | - | 120467..120784 (+) | 318 | WP_053515047.1 | hypothetical protein | - |
| A9256_RS00835 (A9256_00835) | - | 120757..121215 (+) | 459 | WP_053515048.1 | hypothetical protein | - |
| A9256_RS00840 (A9256_00840) | - | 121208..123406 (+) | 2199 | WP_053515049.1 | phage tail protein | - |
| A9256_RS00845 (A9256_00845) | - | 123417..124925 (+) | 1509 | WP_053515074.1 | distal tail protein Dit | - |
| A9256_RS00850 (A9256_00850) | - | 124916..129883 (+) | 4968 | WP_061811550.1 | glucosaminidase domain-containing protein | - |
| A9256_RS00855 (A9256_00855) | - | 129884..131887 (+) | 2004 | WP_061811551.1 | DUF859 family phage minor structural protein | - |
| A9256_RS00860 (A9256_00860) | - | 131899..132291 (+) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| A9256_RS11510 | - | 132314..132442 (+) | 129 | WP_017647842.1 | hypothetical protein | - |
| A9256_RS00865 (A9256_00865) | - | 132451..132753 (+) | 303 | WP_017647841.1 | hypothetical protein | - |
| A9256_RS00870 (A9256_00870) | - | 132746..132973 (+) | 228 | WP_000609111.1 | phage holin | - |
| A9256_RS00875 (A9256_00875) | - | 133099..134433 (+) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| A9256_RS00880 (A9256_00880) | - | 134577..134828 (-) | 252 | WP_000455662.1 | hypothetical protein | - |
| A9256_RS11295 | - | 134969..135115 (-) | 147 | WP_001030869.1 | hypothetical protein | - |
| A9256_RS00885 (A9256_00885) | - | 135265..135474 (+) | 210 | WP_000424774.1 | helix-turn-helix domain-containing protein | - |
| A9256_RS00890 (A9256_00890) | prx | 135597..135779 (+) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| A9256_RS00895 (A9256_00895) | - | 135992..136684 (+) | 693 | WP_000049272.1 | histidine phosphatase family protein | - |
| A9256_RS00900 (A9256_00900) | - | 136681..137433 (+) | 753 | WP_000739808.1 | M15 family metallopeptidase | - |
| A9256_RS00905 (A9256_00905) | - | 137430..138005 (+) | 576 | WP_001231504.1 | glycoside hydrolase family 73 protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6933.00 Da Isoelectric Point: 4.2702
>NTDB_id=187737 A9256_RS00890 WP_017647839.1 135597..135779(+) (prx) [Streptococcus agalactiae strain FWL1402]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=187737 A9256_RS00890 WP_017647839.1 135597..135779(+) (prx) [Streptococcus agalactiae strain FWL1402]
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |