Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLUC77_RS08185 | Genome accession | NZ_CP015906 |
| Coordinates | 1584979..1585431 (-) | Length | 150 a.a. |
| NCBI ID | WP_010905690.1 | Uniprot ID | A0AAC9R1D2 |
| Organism | Lactococcus lactis subsp. lactis strain UC77 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1544091..1596631 | 1584979..1585431 | within | 0 |
Gene organization within MGE regions
Location: 1544091..1596631
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC77_RS07880 (LLUC77_1201) | nth | 1544091..1544747 (-) | 657 | WP_003130627.1 | endonuclease III | - |
| LLUC77_RS07885 (LLUC77_1200) | - | 1544769..1545437 (-) | 669 | WP_010905741.1 | DnaD domain-containing protein | - |
| LLUC77_RS07890 (LLUC77_1198) | - | 1545844..1547115 (-) | 1272 | WP_031296484.1 | dihydroorotase | - |
| LLUC77_RS07895 (LLUC77_1197) | pyrE | 1547270..1547899 (-) | 630 | WP_003132758.1 | orotate phosphoribosyltransferase | - |
| LLUC77_RS07900 (LLUC77_03170) | - | 1547880..1548008 (+) | 129 | WP_003132757.1 | hypothetical protein | - |
| LLUC77_RS07905 (LLUC77_1195) | - | 1548481..1548642 (-) | 162 | WP_021214547.1 | hypothetical protein | - |
| LLUC77_RS07910 (LLUC77_1194) | - | 1548707..1548895 (-) | 189 | WP_017864422.1 | hypothetical protein | - |
| LLUC77_RS07915 (LLUC77_1193) | - | 1548929..1549111 (-) | 183 | WP_003132753.1 | hypothetical protein | - |
| LLUC77_RS07920 (LLUC77_1192) | - | 1549121..1549852 (-) | 732 | WP_003132752.1 | hypothetical protein | - |
| LLUC77_RS07925 (LLUC77_1191) | - | 1550099..1550956 (-) | 858 | WP_010905739.1 | XRE/MutR family transcriptional regulator | - |
| LLUC77_RS07930 (LLUC77_1190) | - | 1551131..1551316 (-) | 186 | WP_003132749.1 | hypothetical protein | - |
| LLUC77_RS07935 (LLUC77_1189) | - | 1551832..1552197 (-) | 366 | WP_003132744.1 | hypothetical protein | - |
| LLUC77_RS07940 (LLUC77_1188) | - | 1552199..1552999 (-) | 801 | WP_010905736.1 | hypothetical protein | - |
| LLUC77_RS07945 (LLUC77_1187) | - | 1553188..1555095 (-) | 1908 | WP_021214548.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| LLUC77_RS07950 (LLUC77_1186) | - | 1555273..1555665 (-) | 393 | WP_003132739.1 | Spx/MgsR family RNA polymerase-binding regulatory protein | - |
| LLUC77_RS07955 (LLUC77_1185) | - | 1555890..1556540 (+) | 651 | WP_023349143.1 | redox-sensing transcriptional repressor Rex | - |
| LLUC77_RS07960 (LLUC77_1184) | - | 1557042..1557821 (-) | 780 | WP_010905733.1 | peptidoglycan amidohydrolase family protein | - |
| LLUC77_RS07965 (LLUC77_1183) | - | 1557821..1558108 (-) | 288 | WP_010905732.1 | phage holin | - |
| LLUC77_RS07970 (LLUC77_1182) | - | 1558121..1558345 (-) | 225 | WP_010905731.1 | hemolysin XhlA family protein | - |
| LLUC77_RS07975 (LLUC77_1181) | - | 1558371..1558598 (-) | 228 | WP_010905730.1 | hypothetical protein | - |
| LLUC77_RS07980 (LLUC77_1180) | - | 1558600..1558938 (-) | 339 | WP_010905729.1 | hypothetical protein | - |
| LLUC77_RS07985 (LLUC77_1178) | - | 1559391..1560221 (-) | 831 | WP_010905727.1 | hypothetical protein | - |
| LLUC77_RS07990 (LLUC77_1177) | - | 1560214..1561815 (-) | 1602 | WP_010905726.1 | DUF2479 domain-containing protein | - |
| LLUC77_RS07995 (LLUC77_1176) | - | 1561828..1564512 (-) | 2685 | WP_023349144.1 | phage tail spike protein | - |
| LLUC77_RS08000 (LLUC77_1175) | - | 1564509..1565258 (-) | 750 | WP_010905724.1 | hypothetical protein | - |
| LLUC77_RS08005 (LLUC77_1174) | - | 1565259..1567520 (-) | 2262 | WP_010905723.1 | phage tail tape measure protein | - |
| LLUC77_RS08010 (LLUC77_03175) | - | 1567534..1567710 (-) | 177 | WP_010905722.1 | hypothetical protein | - |
| LLUC77_RS08015 (LLUC77_1173) | - | 1567737..1568096 (-) | 360 | WP_010905721.1 | hypothetical protein | - |
| LLUC77_RS08020 (LLUC77_1172) | - | 1568106..1568714 (-) | 609 | WP_010905720.1 | major tail protein | - |
| LLUC77_RS08025 (LLUC77_1171) | - | 1568732..1569049 (-) | 318 | WP_010905719.1 | hypothetical protein | - |
| LLUC77_RS08030 (LLUC77_1170) | - | 1569046..1569417 (-) | 372 | WP_010905718.1 | HK97 gp10 family phage protein | - |
| LLUC77_RS08035 (LLUC77_1169) | - | 1569407..1569724 (-) | 318 | WP_010905717.1 | phage head closure protein | - |
| LLUC77_RS08040 (LLUC77_1168) | - | 1569711..1569992 (-) | 282 | WP_010905716.1 | hypothetical protein | - |
| LLUC77_RS08045 (LLUC77_1167) | - | 1569985..1570842 (-) | 858 | WP_010905715.1 | hypothetical protein | - |
| LLUC77_RS08050 (LLUC77_1166) | - | 1570897..1572090 (-) | 1194 | WP_010905714.1 | phage major capsid protein | - |
| LLUC77_RS08055 (LLUC77_1165) | - | 1572062..1572658 (-) | 597 | WP_010905713.1 | HK97 family phage prohead protease | - |
| LLUC77_RS08060 (LLUC77_1164) | - | 1572673..1573878 (-) | 1206 | WP_010905712.1 | phage portal protein | - |
| LLUC77_RS08065 (LLUC77_1163) | - | 1573892..1575661 (-) | 1770 | WP_032941531.1 | terminase large subunit | - |
| LLUC77_RS08070 (LLUC77_1162) | - | 1575654..1576022 (-) | 369 | WP_010905710.1 | P27 family phage terminase small subunit | - |
| LLUC77_RS08075 (LLUC77_1161) | - | 1576114..1576413 (-) | 300 | WP_023349146.1 | HNH endonuclease | - |
| LLUC77_RS08080 (LLUC77_1160) | - | 1576677..1577078 (-) | 402 | WP_011835815.1 | DUF722 domain-containing protein | - |
| LLUC77_RS08085 (LLUC77_1159) | - | 1577156..1577449 (-) | 294 | WP_010905707.1 | DUF1359 domain-containing protein | - |
| LLUC77_RS08090 (LLUC77_1157) | - | 1577813..1577995 (-) | 183 | WP_010905705.1 | hypothetical protein | - |
| LLUC77_RS08095 (LLUC77_1156) | - | 1577992..1578291 (-) | 300 | WP_010905704.1 | hypothetical protein | - |
| LLUC77_RS08100 (LLUC77_1155) | - | 1578292..1578465 (-) | 174 | WP_010905703.1 | DUF1660 domain-containing protein | - |
| LLUC77_RS08105 (LLUC77_1154) | - | 1578507..1578692 (-) | 186 | WP_010905702.1 | hypothetical protein | - |
| LLUC77_RS08110 (LLUC77_1153) | - | 1578739..1578903 (-) | 165 | WP_010905701.1 | hypothetical protein | - |
| LLUC77_RS08115 (LLUC77_1152) | - | 1578925..1579269 (-) | 345 | WP_223203818.1 | hypothetical protein | - |
| LLUC77_RS08120 (LLUC77_1151) | - | 1579262..1579759 (-) | 498 | WP_010905699.1 | hypothetical protein | - |
| LLUC77_RS08125 (LLUC77_1150) | - | 1579762..1580181 (-) | 420 | WP_010905698.1 | dUTP diphosphatase | - |
| LLUC77_RS08130 (LLUC77_1149) | - | 1580178..1580732 (-) | 555 | WP_010905358.1 | DUF1642 domain-containing protein | - |
| LLUC77_RS08135 (LLUC77_1148) | - | 1580729..1581001 (-) | 273 | WP_010905357.1 | hypothetical protein | - |
| LLUC77_RS08140 (LLUC77_1147) | - | 1580994..1581200 (-) | 207 | WP_010905356.1 | DUF1125 domain-containing protein | - |
| LLUC77_RS08145 (LLUC77_1146) | - | 1581394..1581963 (-) | 570 | WP_010905697.1 | DUF658 family protein | - |
| LLUC77_RS08150 (LLUC77_1145) | - | 1581953..1582132 (-) | 180 | WP_010905696.1 | DUF1497 domain-containing protein | - |
| LLUC77_RS08155 (LLUC77_1144) | - | 1582154..1582414 (-) | 261 | WP_223203848.1 | hypothetical protein | - |
| LLUC77_RS08160 (LLUC77_03180) | - | 1582532..1582771 (-) | 240 | WP_031297271.1 | DUF1031 family protein | - |
| LLUC77_RS08165 (LLUC77_1143) | - | 1582764..1582958 (-) | 195 | WP_010905693.1 | hypothetical protein | - |
| LLUC77_RS08170 (LLUC77_1142) | - | 1582961..1583350 (-) | 390 | WP_002819817.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLUC77_RS08175 (LLUC77_1141) | - | 1583347..1584072 (-) | 726 | WP_015966759.1 | hypothetical protein | - |
| LLUC77_RS08180 (LLUC77_1140) | - | 1584072..1584854 (-) | 783 | WP_015966758.1 | phage replisome organiser protein | - |
| LLUC77_RS08185 (LLUC77_1139) | ssb | 1584979..1585431 (-) | 453 | WP_010905690.1 | single-stranded DNA-binding protein | Machinery gene |
| LLUC77_RS08190 (LLUC77_1138) | - | 1585431..1586054 (-) | 624 | WP_010905689.1 | DUF1071 domain-containing protein | - |
| LLUC77_RS08195 (LLUC77_1137) | - | 1586063..1586581 (-) | 519 | WP_010905688.1 | host-nuclease inhibitor Gam family protein | - |
| LLUC77_RS08200 (LLUC77_1136) | - | 1586697..1586912 (-) | 216 | WP_015966756.1 | DUF1408 domain-containing protein | - |
| LLUC77_RS08205 (LLUC77_1135) | - | 1587015..1587290 (+) | 276 | WP_023349243.1 | hypothetical protein | - |
| LLUC77_RS08210 (LLUC77_03185) | - | 1587287..1587481 (-) | 195 | WP_010905685.1 | hypothetical protein | - |
| LLUC77_RS08215 (LLUC77_1133) | - | 1587619..1587954 (-) | 336 | WP_003131910.1 | DUF771 domain-containing protein | - |
| LLUC77_RS08220 (LLUC77_1132) | - | 1587967..1588710 (-) | 744 | WP_010905684.1 | ORF6C domain-containing protein | - |
| LLUC77_RS08225 (LLUC77_1131) | - | 1588747..1588965 (-) | 219 | WP_010905683.1 | DUF739 family protein | - |
| LLUC77_RS08230 (LLUC77_1130) | - | 1589134..1589676 (+) | 543 | WP_010905682.1 | helix-turn-helix domain-containing protein | - |
| LLUC77_RS08235 (LLUC77_1129) | - | 1589673..1590110 (+) | 438 | WP_010905681.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LLUC77_RS08240 (LLUC77_1128) | - | 1590167..1590712 (+) | 546 | WP_023349242.1 | PH domain-containing protein | - |
| LLUC77_RS08245 (LLUC77_1127) | - | 1590835..1591959 (+) | 1125 | WP_010905679.1 | site-specific integrase | - |
| LLUC77_RS08250 (LLUC77_1126) | radC | 1592158..1592838 (-) | 681 | WP_003131898.1 | DNA repair protein RadC | - |
| LLUC77_RS08255 (LLUC77_1125) | glmS | 1592969..1594786 (-) | 1818 | WP_081172149.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| LLUC77_RS08260 (LLUC77_1124) | - | 1595093..1595983 (+) | 891 | WP_043736692.1 | IS982-like element ISLll1 family transposase | - |
| LLUC77_RS08265 (LLUC77_1123) | - | 1595984..1596631 (-) | 648 | WP_081172147.1 | phosphatase PAP2 family protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16643.67 Da Isoelectric Point: 8.9728
>NTDB_id=183270 LLUC77_RS08185 WP_010905690.1 1584979..1585431(-) (ssb) [Lactococcus lactis subsp. lactis strain UC77]
MINNVVLVGRLTRDPELRHTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTR
NYENQQGQKVYVTEVVADTFQMLESNKTQGQQTSKPQAQNKKPQAPDPFKAPAADPFAGGTEISDDDLPF
MINNVVLVGRLTRDPELRHTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTR
NYENQQGQKVYVTEVVADTFQMLESNKTQGQQTSKPQAQNKKPQAPDPFKAPAADPFAGGTEISDDDLPF
Nucleotide
Download Length: 453 bp
>NTDB_id=183270 LLUC77_RS08185 WP_010905690.1 1584979..1585431(-) (ssb) [Lactococcus lactis subsp. lactis strain UC77]
ATGATTAATAATGTTGTATTAGTAGGTCGCTTAACTCGTGACCCTGAACTTAGACATACACCACAGAACCAAGCAGTAGG
TACATTTGGATTAGCTGTAAATCGCCAGTTTAAAAATGCGAATGGCGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGACAACAAGCCGAAAATTTAGCTAAGTTTGCTAAAAAAGGAGCTTTGATTGGAATAACTGGACGGATTCAAACAAGG
AACTATGAGAACCAACAAGGACAAAAAGTTTATGTTACCGAAGTTGTTGCAGATACTTTCCAAATGCTAGAAAGCAATAA
AACACAAGGTCAGCAAACAAGTAAACCGCAAGCTCAAAATAAAAAGCCACAAGCACCAGACCCTTTTAAAGCTCCTGCTG
CTGATCCATTTGCTGGTGGTACTGAAATTTCAGATGATGACCTACCATTTTAA
ATGATTAATAATGTTGTATTAGTAGGTCGCTTAACTCGTGACCCTGAACTTAGACATACACCACAGAACCAAGCAGTAGG
TACATTTGGATTAGCTGTAAATCGCCAGTTTAAAAATGCGAATGGCGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGACAACAAGCCGAAAATTTAGCTAAGTTTGCTAAAAAAGGAGCTTTGATTGGAATAACTGGACGGATTCAAACAAGG
AACTATGAGAACCAACAAGGACAAAAAGTTTATGTTACCGAAGTTGTTGCAGATACTTTCCAAATGCTAGAAAGCAATAA
AACACAAGGTCAGCAAACAAGTAAACCGCAAGCTCAAAATAAAAAGCCACAAGCACCAGACCCTTTTAAAGCTCCTGCTG
CTGATCCATTTGCTGGTGGTACTGAAATTTCAGATGATGACCTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.14 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.607 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.654 |
69.333 |
0.407 |
| ssb | Neisseria meningitidis MC58 |
34.302 |
100 |
0.393 |
| ssb | Neisseria gonorrhoeae MS11 |
33.721 |
100 |
0.387 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
52.381 |
70 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
51.429 |
70 |
0.36 |