Detailed information NTG0180510

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: A2I66_RS07270
• Genome accession: NZ_CP015535
• Coordinates: 1462638..1462964 (+)
• Length: 108 a.a.
• NCBI ID: WP_015900413.1
• Uniprot ID: -
• Organism: Staphylococcus carnosus strain TMW 2.218
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1457638..1467964

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A2I66_RS07240 (A2I66_07095)	-	1458392..1458592 (+)	201	WP_015900419.1	YqgQ family protein	-
A2I66_RS07245 (A2I66_07100)	-	1458592..1459578 (+)	987	WP_015900418.1	ROK family glucokinase	-
A2I66_RS07250 (A2I66_07105)	-	1459578..1459907 (+)	330	WP_015900417.1	MTH1187 family thiamine-binding protein	-
A2I66_RS07255 (A2I66_07110)	-	1459907..1460530 (+)	624	WP_015900416.1	MBL fold metallo-hydrolase	-
A2I66_RS07260 (A2I66_07115)	comGA	1460601..1461593 (+)	993	WP_065865449.1	competence type IV pilus ATPase ComGA	Machinery gene
A2I66_RS07265 (A2I66_07120)	comGB	1461547..1462620 (+)	1074	WP_253719962.1	competence type IV pilus assembly protein ComGB	-
A2I66_RS07270 (A2I66_07125)	comGC	1462638..1462964 (+)	327	WP_015900413.1	competence type IV pilus major pilin ComGC	Machinery gene
A2I66_RS07275 (A2I66_07130)	-	1462984..1463397 (+)	414	WP_231635362.1	prepilin-type cleavage/methylation domain-containing protein	-
A2I66_RS07280 (A2I66_07135)	-	1463378..1463674 (+)	297	WP_041612977.1	hypothetical protein	-
A2I66_RS07285 (A2I66_07140)	comGF	1463631..1464089 (+)	459	WP_158297486.1	competence type IV pilus minor pilin ComGF	-
A2I66_RS07290 (A2I66_07145)	-	1464260..1464799 (+)	540	WP_046099279.1	shikimate kinase	-
A2I66_RS07295 (A2I66_07150)	gcvT	1464990..1466084 (+)	1095	WP_015900410.1	glycine cleavage system aminomethyltransferase GcvT	-
A2I66_RS07300 (A2I66_07155)	gcvPA	1466105..1467451 (+)	1347	WP_253719964.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12186.36 Da
• Isoelectric Point: 9.8933

>NTDB_id=180510 A2I66_RS07270 WP_015900413.1 1462638..1462964(+) (comGC) [Staphylococcus carnosus strain TMW 2.218]
MKRYYFKLKNKNLKAFTLLEMLLVLLVISVLLILIIPNIAKQSEHVQATGCEAQQKMVNSQIEAYSLKNNRKPDSIDELV
TQGYLKEAQKKCKSGESITIKNGEASIS

Nucleotide

• Length: 327 bp

>NTDB_id=180510 A2I66_RS07270 WP_015900413.1 1462638..1462964(+) (comGC) [Staphylococcus carnosus strain TMW 2.218]
ATGAAAAGATATTACTTTAAATTGAAAAATAAAAACTTAAAAGCTTTTACATTGTTAGAAATGCTGCTTGTATTATTGGT
TATTAGTGTATTATTAATTTTAATTATACCGAATATCGCTAAACAATCTGAACATGTCCAGGCTACAGGTTGTGAGGCAC
AACAAAAAATGGTGAATAGTCAAATAGAAGCTTATTCACTTAAAAATAATAGAAAACCTGATAGTATTGATGAACTTGTT
ACACAAGGATATTTAAAAGAAGCTCAAAAGAAGTGTAAATCAGGAGAAAGTATAACAATAAAAAATGGTGAAGCATCAAT
TAGCTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-35)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	72.632	87.963	0.639
comGC	Staphylococcus aureus N315	72.632	87.963	0.639
comGC/cglC	Streptococcus mitis SK321	45.283	98.148	0.444
comGC/cglC	Streptococcus pneumoniae R6	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae D39	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae TIGR4	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae Rx1	44.34	98.148	0.435
comGC/cglC	Streptococcus mitis NCTC 12261	47.826	85.185	0.407
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	76.852	0.38
comGC	Bacillus subtilis subsp. subtilis str. 168	40.625	88.889	0.361