Detailed information NTG0180442

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: A2I65_RS07045
• Genome accession: NZ_CP015532
• Coordinates: 1432589..1432915 (+)
• Length: 108 a.a.
• NCBI ID: WP_015900413.1
• Uniprot ID: -
• Organism: Staphylococcus carnosus strain TMW 2.212
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1427589..1437915

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A2I65_RS07015 (A2I65_06870)	-	1428343..1428543 (+)	201	WP_015900419.1	YqgQ family protein	-
A2I65_RS07020 (A2I65_06875)	-	1428543..1429529 (+)	987	WP_015900418.1	ROK family glucokinase	-
A2I65_RS07025 (A2I65_06880)	-	1429529..1429858 (+)	330	WP_015900417.1	MTH1187 family thiamine-binding protein	-
A2I65_RS07030 (A2I65_06885)	-	1429858..1430481 (+)	624	WP_253719958.1	MBL fold metallo-hydrolase	-
A2I65_RS07035 (A2I65_06890)	comGA	1430552..1431544 (+)	993	WP_253719960.1	competence type IV pilus ATPase ComGA	Machinery gene
A2I65_RS07040 (A2I65_06895)	comGB	1431498..1432571 (+)	1074	WP_253719962.1	competence type IV pilus assembly protein ComGB	-
A2I65_RS07045 (A2I65_06900)	comGC	1432589..1432915 (+)	327	WP_015900413.1	competence type IV pilus major pilin ComGC	Machinery gene
A2I65_RS07050 (A2I65_06905)	-	1432935..1433348 (+)	414	WP_231635362.1	prepilin-type cleavage/methylation domain-containing protein	-
A2I65_RS07055 (A2I65_06910)	-	1433329..1433625 (+)	297	WP_041612977.1	hypothetical protein	-
A2I65_RS07060 (A2I65_06915)	comGF	1433582..1434040 (+)	459	WP_158297486.1	competence type IV pilus minor pilin ComGF	-
A2I65_RS07065 (A2I65_06920)	-	1434211..1434750 (+)	540	WP_046099279.1	shikimate kinase	-
A2I65_RS07070 (A2I65_06925)	gcvT	1434941..1436035 (+)	1095	WP_015900410.1	glycine cleavage system aminomethyltransferase GcvT	-
A2I65_RS07075 (A2I65_06930)	gcvPA	1436056..1437402 (+)	1347	WP_253719964.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12186.36 Da
• Isoelectric Point: 9.8933

>NTDB_id=180442 A2I65_RS07045 WP_015900413.1 1432589..1432915(+) (comGC) [Staphylococcus carnosus strain TMW 2.212]
MKRYYFKLKNKNLKAFTLLEMLLVLLVISVLLILIIPNIAKQSEHVQATGCEAQQKMVNSQIEAYSLKNNRKPDSIDELV
TQGYLKEAQKKCKSGESITIKNGEASIS

Nucleotide

• Length: 327 bp

>NTDB_id=180442 A2I65_RS07045 WP_015900413.1 1432589..1432915(+) (comGC) [Staphylococcus carnosus strain TMW 2.212]
ATGAAAAGATATTACTTTAAATTGAAAAATAAAAACTTAAAAGCTTTTACATTGTTAGAAATGCTGCTTGTATTATTGGT
TATTAGTGTATTATTAATTTTAATTATACCGAATATCGCTAAACAATCTGAACATGTCCAGGCTACAGGTTGTGAGGCAC
AACAAAAAATGGTGAATAGTCAAATAGAAGCTTATTCACTTAAAAATAATAGAAAACCTGATAGTATTGATGAACTTGTT
ACACAAGGATATTTAAAAGAAGCTCAAAAGAAGTGTAAATCAGGAGAAAGTATAACAATAAAAAATGGTGAAGCATCAAT
TAGCTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-35)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	72.632	87.963	0.639
comGC	Staphylococcus aureus N315	72.632	87.963	0.639
comGC/cglC	Streptococcus mitis SK321	45.283	98.148	0.444
comGC/cglC	Streptococcus pneumoniae R6	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae D39	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae TIGR4	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae Rx1	44.34	98.148	0.435
comGC/cglC	Streptococcus mitis NCTC 12261	47.826	85.185	0.407
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	76.852	0.38
comGC	Bacillus subtilis subsp. subtilis str. 168	40.625	88.889	0.361