Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | BtBc_RS26915 | Genome accession | NZ_CP015150 |
| Coordinates | 5261009..5261590 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049162.1 | Uniprot ID | A0A9W5QPC2 |
| Organism | Bacillus thuringiensis strain Bc601 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5211197..5263140 | 5261009..5261590 | within | 0 |
Gene organization within MGE regions
Location: 5211197..5263140
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BtBc_RS26570 (BtBc_26570) | cggR | 5211197..5212225 (-) | 1029 | WP_001258185.1 | gapA transcriptional regulator CggR | - |
| BtBc_RS26575 (BtBc_26575) | - | 5212361..5212606 (-) | 246 | WP_000869730.1 | glutaredoxin family protein | - |
| BtBc_RS26580 (BtBc_26580) | rpoN | 5212616..5213923 (-) | 1308 | WP_000647955.1 | RNA polymerase factor sigma-54 | - |
| BtBc_RS26585 (BtBc_26585) | - | 5214486..5215313 (+) | 828 | WP_000412580.1 | helix-turn-helix domain-containing protein | - |
| BtBc_RS26590 (BtBc_26590) | - | 5215329..5215622 (-) | 294 | WP_001273481.1 | YolD-like family protein | - |
| BtBc_RS26595 (BtBc_26595) | - | 5215647..5215865 (-) | 219 | WP_001016121.1 | hypothetical protein | - |
| BtBc_RS26600 (BtBc_26600) | - | 5216009..5216575 (+) | 567 | WP_000742864.1 | hypothetical protein | - |
| BtBc_RS26605 (BtBc_26605) | - | 5216754..5216972 (-) | 219 | WP_000734384.1 | hypothetical protein | - |
| BtBc_RS26610 (BtBc_26610) | - | 5216972..5218087 (-) | 1116 | WP_000993515.1 | Rap family tetratricopeptide repeat protein | - |
| BtBc_RS26615 (BtBc_26615) | - | 5218291..5219226 (-) | 936 | WP_000405783.1 | N-acetylmuramoyl-L-alanine amidase | - |
| BtBc_RS26620 (BtBc_26620) | - | 5219524..5220717 (+) | 1194 | WP_000499524.1 | IS110 family transposase | - |
| BtBc_RS26625 (BtBc_26625) | - | 5220779..5221222 (-) | 444 | WP_042991251.1 | phage holin family protein | - |
| BtBc_RS26630 (BtBc_26630) | - | 5221517..5222710 (+) | 1194 | WP_000499524.1 | IS110 family transposase | - |
| BtBc_RS26635 (BtBc_26635) | - | 5222831..5223202 (-) | 372 | WP_016090170.1 | hypothetical protein | - |
| BtBc_RS26640 (BtBc_26640) | - | 5223219..5227601 (-) | 4383 | WP_015382502.1 | phage tail spike protein | - |
| BtBc_RS26645 (BtBc_26645) | - | 5227598..5229067 (-) | 1470 | WP_015382503.1 | distal tail protein Dit | - |
| BtBc_RS26650 (BtBc_26650) | - | 5229109..5231490 (-) | 2382 | WP_002133928.1 | hypothetical protein | - |
| BtBc_RS26655 (BtBc_26655) | - | 5231768..5233003 (-) | 1236 | WP_000897021.1 | hypothetical protein | - |
| BtBc_RS26660 (BtBc_26660) | - | 5233234..5233596 (-) | 363 | WP_000415931.1 | hypothetical protein | - |
| BtBc_RS26665 (BtBc_26665) | - | 5233603..5234196 (-) | 594 | WP_001004920.1 | major tail protein | - |
| BtBc_RS26670 (BtBc_26670) | - | 5234197..5234532 (-) | 336 | WP_000219080.1 | hypothetical protein | - |
| BtBc_RS26675 (BtBc_26675) | - | 5234529..5234873 (-) | 345 | WP_000997537.1 | HK97 gp10 family phage protein | - |
| BtBc_RS26680 (BtBc_26680) | - | 5234875..5235225 (-) | 351 | WP_001247297.1 | phage head closure protein | - |
| BtBc_RS26685 (BtBc_26685) | - | 5235227..5235520 (-) | 294 | WP_000361981.1 | hypothetical protein | - |
| BtBc_RS26690 (BtBc_26690) | - | 5235533..5236675 (-) | 1143 | WP_086401347.1 | phage major capsid protein | - |
| BtBc_RS26695 (BtBc_26695) | - | 5236726..5237451 (-) | 726 | WP_000791073.1 | head maturation protease, ClpP-related | - |
| BtBc_RS26700 (BtBc_26700) | - | 5237441..5238592 (-) | 1152 | WP_000118683.1 | phage portal protein | - |
| BtBc_RS26705 (BtBc_26705) | - | 5238613..5240298 (-) | 1686 | WP_000595321.1 | terminase large subunit | - |
| BtBc_RS26710 (BtBc_26710) | - | 5240295..5240606 (-) | 312 | WP_000301150.1 | P27 family phage terminase small subunit | - |
| BtBc_RS26715 (BtBc_26715) | - | 5240731..5241066 (-) | 336 | WP_000666398.1 | HNH endonuclease | - |
| BtBc_RS26720 (BtBc_26720) | - | 5241032..5241406 (-) | 375 | WP_001177571.1 | hypothetical protein | - |
| BtBc_RS26725 (BtBc_26725) | - | 5241397..5241654 (-) | 258 | WP_000378699.1 | hypothetical protein | - |
| BtBc_RS26730 (BtBc_26730) | - | 5241661..5241870 (-) | 210 | WP_001177575.1 | hypothetical protein | - |
| BtBc_RS26735 (BtBc_26735) | - | 5241939..5242373 (-) | 435 | WP_001002014.1 | hypothetical protein | - |
| BtBc_RS26740 (BtBc_26740) | - | 5242379..5242582 (-) | 204 | WP_000343502.1 | hypothetical protein | - |
| BtBc_RS26745 (BtBc_26745) | - | 5242596..5242820 (-) | 225 | WP_000650576.1 | hypothetical protein | - |
| BtBc_RS32970 | - | 5243057..5243182 (+) | 126 | WP_306426678.1 | type II toxin-antitoxin system HicA family toxin | - |
| BtBc_RS26750 (BtBc_26750) | - | 5243234..5243653 (+) | 420 | WP_000711194.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| BtBc_RS26755 (BtBc_26755) | - | 5244037..5244438 (-) | 402 | WP_003308641.1 | hypothetical protein | - |
| BtBc_RS26760 (BtBc_26760) | - | 5244476..5244802 (-) | 327 | WP_015670520.1 | hypothetical protein | - |
| BtBc_RS26765 (BtBc_26765) | recU | 5244799..5245326 (-) | 528 | WP_000540086.1 | Holliday junction resolvase RecU | - |
| BtBc_RS26770 (BtBc_26770) | - | 5245362..5245673 (-) | 312 | WP_000590881.1 | hypothetical protein | - |
| BtBc_RS26775 (BtBc_26775) | - | 5245718..5246413 (-) | 696 | WP_000858114.1 | hypothetical protein | - |
| BtBc_RS26780 (BtBc_26780) | - | 5246449..5246703 (-) | 255 | WP_000520932.1 | hypothetical protein | - |
| BtBc_RS26785 (BtBc_26785) | - | 5246786..5247579 (-) | 794 | Protein_5318 | prohibitin family protein | - |
| BtBc_RS33905 | - | 5247581..5247721 (-) | 141 | WP_000492043.1 | hypothetical protein | - |
| BtBc_RS26790 (BtBc_26790) | - | 5247726..5248016 (-) | 291 | WP_001268031.1 | hypothetical protein | - |
| BtBc_RS26795 (BtBc_26795) | - | 5248075..5248509 (-) | 435 | WP_000775809.1 | hypothetical protein | - |
| BtBc_RS26800 (BtBc_26800) | - | 5248548..5249105 (-) | 558 | WP_001245738.1 | hypothetical protein | - |
| BtBc_RS26805 (BtBc_26805) | - | 5249129..5249359 (-) | 231 | WP_000139235.1 | hypothetical protein | - |
| BtBc_RS26810 (BtBc_26810) | - | 5249352..5249831 (-) | 480 | WP_000933908.1 | hypothetical protein | - |
| BtBc_RS26815 (BtBc_26815) | - | 5249843..5250796 (-) | 954 | WP_000510889.1 | DnaD domain protein | - |
| BtBc_RS26820 (BtBc_26820) | - | 5250890..5251231 (-) | 342 | WP_002133909.1 | hypothetical protein | - |
| BtBc_RS26825 (BtBc_26825) | - | 5251161..5251376 (-) | 216 | WP_000355713.1 | hypothetical protein | - |
| BtBc_RS26830 (BtBc_26830) | - | 5251376..5252089 (-) | 714 | WP_015382506.1 | hypothetical protein | - |
| BtBc_RS26835 (BtBc_26835) | - | 5252107..5252550 (-) | 444 | WP_000453495.1 | hypothetical protein | - |
| BtBc_RS26840 (BtBc_26840) | - | 5252577..5252765 (-) | 189 | WP_001187283.1 | hypothetical protein | - |
| BtBc_RS26845 (BtBc_26845) | - | 5252777..5253532 (-) | 756 | WP_001016247.1 | phage regulatory protein | - |
| BtBc_RS33910 | - | 5253547..5253702 (-) | 156 | WP_000788383.1 | hypothetical protein | - |
| BtBc_RS26850 (BtBc_26850) | - | 5253886..5254119 (-) | 234 | WP_000711864.1 | DUF771 domain-containing protein | - |
| BtBc_RS26855 (BtBc_26855) | - | 5254155..5254385 (-) | 231 | WP_000216290.1 | helix-turn-helix transcriptional regulator | - |
| BtBc_RS26860 (BtBc_26860) | - | 5254550..5254942 (+) | 393 | WP_002133807.1 | helix-turn-helix transcriptional regulator | - |
| BtBc_RS26865 (BtBc_26865) | - | 5254953..5255420 (+) | 468 | WP_001037137.1 | hypothetical protein | - |
| BtBc_RS26870 (BtBc_26870) | - | 5255451..5256587 (+) | 1137 | WP_000135757.1 | tyrosine-type recombinase/integrase | - |
| BtBc_RS26880 (BtBc_26880) | - | 5257002..5257208 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| BtBc_RS26885 (BtBc_26885) | - | 5257302..5257790 (+) | 489 | WP_001226064.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| BtBc_RS26890 (BtBc_26890) | spoVAC | 5257820..5258296 (+) | 477 | WP_000095408.1 | stage V sporulation protein AC | - |
| BtBc_RS26895 (BtBc_26895) | spoVAD | 5258297..5259313 (+) | 1017 | WP_000938972.1 | stage V sporulation protein AD | - |
| BtBc_RS26900 (BtBc_26900) | spoVAE | 5259310..5259660 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| BtBc_RS26905 (BtBc_26905) | - | 5259672..5259878 (+) | 207 | WP_000215909.1 | DUF1657 domain-containing protein | - |
| BtBc_RS26910 (BtBc_26910) | - | 5259899..5260768 (+) | 870 | WP_000018924.1 | DUF421 domain-containing protein | - |
| BtBc_RS26915 (BtBc_26915) | clpP | 5261009..5261590 (+) | 582 | WP_001049162.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
| BtBc_RS26920 (BtBc_26920) | - | 5261918..5262166 (-) | 249 | WP_000250307.1 | HPr family phosphocarrier protein | - |
| BtBc_RS26925 (BtBc_26925) | whiA | 5262190..5263140 (-) | 951 | WP_000006560.1 | DNA-binding protein WhiA | - |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21419.67 Da Isoelectric Point: 5.0423
>NTDB_id=177163 BtBc_RS26915 WP_001049162.1 5261009..5261590(+) (clpP) [Bacillus thuringiensis strain Bc601]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=177163 BtBc_RS26915 WP_001049162.1 5261009..5261590(+) (clpP) [Bacillus thuringiensis strain Bc601]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
90.104 |
99.482 |
0.896 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |