Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | AYM92_RS06760 | Genome accession | NZ_CP014542 |
| Coordinates | 1283618..1283800 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes strain STAB14018 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1283618..1325054 | 1283618..1283800 | within | 0 |
Gene organization within MGE regions
Location: 1283618..1325054
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM92_RS06760 (AYM92_06565) | prx | 1283618..1283800 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| AYM92_RS06770 (AYM92_06575) | - | 1284146..1284721 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| AYM92_RS06780 (AYM92_06580) | spek | 1285197..1285976 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| AYM92_RS06785 (AYM92_06585) | - | 1286280..1287146 (-) | 867 | WP_076639317.1 | DUF334 domain-containing protein | - |
| AYM92_RS06790 (AYM92_06590) | - | 1287134..1287658 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| AYM92_RS06795 (AYM92_06595) | - | 1287798..1289000 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| AYM92_RS06800 (AYM92_06600) | - | 1289116..1289343 (-) | 228 | WP_011054444.1 | phage holin | - |
| AYM92_RS06805 (AYM92_06605) | - | 1289340..1289612 (-) | 273 | WP_011017397.1 | DUF7365 family protein | - |
| AYM92_RS06810 (AYM92_06610) | - | 1289624..1290256 (-) | 633 | WP_087486719.1 | hypothetical protein | - |
| AYM92_RS06815 (AYM92_06615) | - | 1290259..1290687 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| AYM92_RS06820 (AYM92_06620) | - | 1290699..1292588 (-) | 1890 | WP_047235372.1 | gp58-like family protein | - |
| AYM92_RS06825 (AYM92_06625) | - | 1292599..1292913 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| AYM92_RS06830 (AYM92_06630) | - | 1292915..1294129 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| AYM92_RS06835 (AYM92_06635) | - | 1294126..1296273 (-) | 2148 | WP_087486720.1 | phage tail spike protein | - |
| AYM92_RS06840 (AYM92_06640) | - | 1296270..1296986 (-) | 717 | WP_076639319.1 | distal tail protein Dit | - |
| AYM92_RS06845 (AYM92_06645) | - | 1296983..1300243 (-) | 3261 | WP_076639320.1 | tape measure protein | - |
| AYM92_RS06850 (AYM92_06650) | - | 1300233..1300814 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| AYM92_RS06855 (AYM92_06655) | - | 1300818..1301252 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| AYM92_RS06860 (AYM92_06660) | - | 1301291..1301776 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| AYM92_RS06865 (AYM92_06665) | - | 1301776..1302174 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| AYM92_RS06870 (AYM92_06670) | - | 1302171..1302527 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| AYM92_RS06875 (AYM92_06675) | - | 1302527..1302859 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| AYM92_RS06880 (AYM92_06680) | - | 1302849..1303265 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| AYM92_RS06885 (AYM92_06685) | - | 1303319..1304137 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| AYM92_RS06890 (AYM92_06690) | - | 1304141..1304755 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| AYM92_RS06895 (AYM92_06695) | - | 1304881..1305147 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| AYM92_RS06900 (AYM92_06700) | - | 1305209..1305448 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| AYM92_RS06905 (AYM92_06705) | - | 1305420..1306898 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| AYM92_RS06910 (AYM92_06710) | - | 1306903..1308405 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| AYM92_RS06915 (AYM92_06715) | - | 1308419..1309630 (-) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| AYM92_RS06920 (AYM92_06720) | - | 1309713..1310186 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| AYM92_RS06925 (AYM92_06725) | - | 1310237..1310614 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| AYM92_RS06930 (AYM92_06730) | - | 1310675..1311106 (-) | 432 | WP_074375320.1 | GNAT family N-acetyltransferase | - |
| AYM92_RS06935 (AYM92_06735) | - | 1311084..1311602 (-) | 519 | WP_076639322.1 | ParB N-terminal domain-containing protein | - |
| AYM92_RS06940 | - | 1311683..1311940 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| AYM92_RS06960 (AYM92_06740) | - | 1312579..1313019 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AYM92_RS10030 | - | 1313293..1313463 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| AYM92_RS06965 (AYM92_06745) | - | 1313460..1313966 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| AYM92_RS09905 | - | 1313963..1314133 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| AYM92_RS06970 (AYM92_06750) | - | 1314130..1314534 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| AYM92_RS06975 (AYM92_06755) | - | 1314544..1314813 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| AYM92_RS06980 (AYM92_06760) | - | 1314810..1315094 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| AYM92_RS06985 (AYM92_06765) | - | 1315088..1315339 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| AYM92_RS06990 (AYM92_06770) | - | 1315336..1315692 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| AYM92_RS06995 (AYM92_06775) | - | 1315689..1316129 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYM92_RS07000 (AYM92_06780) | - | 1316129..1316332 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| AYM92_RS07005 (AYM92_06785) | ssbA | 1316338..1316757 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| AYM92_RS07010 (AYM92_06790) | - | 1316750..1317424 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| AYM92_RS07015 (AYM92_06795) | - | 1317425..1317907 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| AYM92_RS07020 (AYM92_06800) | - | 1317929..1318183 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| AYM92_RS07025 | - | 1318194..1318334 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| AYM92_RS07030 (AYM92_06805) | - | 1318331..1318564 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| AYM92_RS07035 (AYM92_06810) | - | 1318545..1318958 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| AYM92_RS10175 (AYM92_06815) | - | 1319080..1319337 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| AYM92_RS07045 (AYM92_06820) | - | 1319431..1319616 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| AYM92_RS07050 (AYM92_06825) | - | 1319645..1319902 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| AYM92_RS07060 | - | 1320148..1320315 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| AYM92_RS07065 (AYM92_06835) | - | 1320391..1320591 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| AYM92_RS10035 | - | 1320588..1320737 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| AYM92_RS07070 (AYM92_06840) | - | 1320770..1321498 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| AYM92_RS07075 (AYM92_06845) | - | 1321509..1321700 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| AYM92_RS07080 (AYM92_06850) | - | 1322502..1322855 (+) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| AYM92_RS07085 (AYM92_06855) | - | 1322869..1323249 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AYM92_RS07090 (AYM92_06860) | - | 1323260..1323781 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| AYM92_RS07095 (AYM92_06865) | - | 1323957..1325054 (+) | 1098 | WP_015967409.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=172413 AYM92_RS06760 WP_011054726.1 1283618..1283800(-) (prx) [Streptococcus pyogenes strain STAB14018]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=172413 AYM92_RS06760 WP_011054726.1 1283618..1283800(-) (prx) [Streptococcus pyogenes strain STAB14018]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |