Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | AYM92_RS06185 | Genome accession | NZ_CP014542 |
| Coordinates | 1182811..1182993 (-) | Length | 60 a.a. |
| NCBI ID | WP_032463717.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain STAB14018 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1182811..1227102 | 1182811..1182993 | within | 0 |
Gene organization within MGE regions
Location: 1182811..1227102
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM92_RS06185 (AYM92_06000) | prx | 1182811..1182993 (-) | 183 | WP_032463717.1 | hypothetical protein | Regulator |
| AYM92_RS06190 (AYM92_06005) | spel | 1183108..1183896 (-) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| AYM92_RS06195 (AYM92_06010) | spem | 1184178..1184831 (-) | 654 | Protein_1153 | streptococcal pyrogenic exotoxin SpeM | - |
| AYM92_RS06200 (AYM92_06015) | - | 1184865..1185461 (+) | 597 | WP_087486717.1 | hypothetical protein | - |
| AYM92_RS06205 (AYM92_06020) | - | 1185472..1185768 (+) | 297 | WP_023078532.1 | hypothetical protein | - |
| AYM92_RS06210 (AYM92_06025) | - | 1185765..1185950 (+) | 186 | WP_011054731.1 | holin | - |
| AYM92_RS06215 (AYM92_06030) | - | 1186061..1186615 (+) | 555 | Protein_1157 | glycoside hydrolase family 73 protein | - |
| AYM92_RS06220 (AYM92_06035) | - | 1186851..1187543 (+) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| AYM92_RS06225 (AYM92_06040) | - | 1187656..1188297 (+) | 642 | Protein_1159 | CHAP domain-containing protein | - |
| AYM92_RS06230 (AYM92_06045) | - | 1188446..1188610 (+) | 165 | WP_021340366.1 | hypothetical protein | - |
| AYM92_RS06235 (AYM92_06050) | - | 1188643..1189203 (+) | 561 | WP_011018106.1 | GNAT family N-acetyltransferase | - |
| AYM92_RS06240 (AYM92_06055) | - | 1189652..1190080 (-) | 429 | WP_032463718.1 | DUF1617 family protein | - |
| AYM92_RS06245 (AYM92_06060) | - | 1190092..1191978 (-) | 1887 | WP_076639305.1 | gp58-like family protein | - |
| AYM92_RS06250 (AYM92_06065) | hylP | 1191993..1193006 (-) | 1014 | WP_032463712.1 | hyaluronidase HylP | - |
| AYM92_RS10290 | - | 1193006..1195111 (-) | 2106 | WP_050436577.1 | phage tail spike protein | - |
| AYM92_RS06260 (AYM92_06075) | - | 1195108..1195878 (-) | 771 | WP_030127447.1 | distal tail protein Dit | - |
| AYM92_RS06265 (AYM92_06080) | - | 1195878..1198625 (-) | 2748 | WP_050436576.1 | phage tail tape measure protein | - |
| AYM92_RS06270 (AYM92_06085) | - | 1198625..1198942 (-) | 318 | WP_030127445.1 | hypothetical protein | - |
| AYM92_RS06275 (AYM92_06090) | - | 1198963..1199331 (-) | 369 | WP_030127444.1 | tail assembly chaperone | - |
| AYM92_RS06280 (AYM92_06095) | - | 1199385..1199903 (-) | 519 | WP_030127443.1 | phage major tail protein, TP901-1 family | - |
| AYM92_RS06285 (AYM92_06100) | - | 1199891..1200289 (-) | 399 | WP_030127442.1 | DUF3168 domain-containing protein | - |
| AYM92_RS06290 (AYM92_06105) | - | 1200286..1200642 (-) | 357 | WP_030127441.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AYM92_RS06295 (AYM92_06110) | - | 1200642..1200938 (-) | 297 | WP_032463711.1 | hypothetical protein | - |
| AYM92_RS06300 (AYM92_06115) | - | 1200935..1201288 (-) | 354 | WP_030127439.1 | phage head-tail connector protein | - |
| AYM92_RS06305 (AYM92_06120) | - | 1201300..1201566 (-) | 267 | WP_030127438.1 | HeH/LEM domain-containing protein | - |
| AYM92_RS06310 (AYM92_06125) | - | 1201578..1202627 (-) | 1050 | WP_030127437.1 | major capsid protein | - |
| AYM92_RS06315 (AYM92_06130) | - | 1202630..1203010 (-) | 381 | WP_002990036.1 | structural protein | - |
| AYM92_RS06320 (AYM92_06135) | - | 1203020..1203553 (-) | 534 | WP_030127436.1 | DUF4355 domain-containing protein | - |
| AYM92_RS06325 (AYM92_06140) | - | 1203697..1203963 (-) | 267 | WP_030127435.1 | hypothetical protein | - |
| AYM92_RS06330 (AYM92_06145) | - | 1203979..1204893 (-) | 915 | WP_032463710.1 | minor capsid protein | - |
| AYM92_RS06335 (AYM92_06150) | - | 1204874..1206364 (-) | 1491 | WP_032461297.1 | phage portal protein | - |
| AYM92_RS06340 (AYM92_06155) | - | 1206376..1207683 (-) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| AYM92_RS06345 (AYM92_06160) | - | 1207661..1208113 (-) | 453 | WP_030127432.1 | terminase small subunit | - |
| AYM92_RS06350 (AYM92_06165) | - | 1208203..1208619 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| AYM92_RS10010 | - | 1208603..1208749 (-) | 147 | WP_023079210.1 | hypothetical protein | - |
| AYM92_RS06355 (AYM92_06170) | - | 1208752..1209024 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| AYM92_RS10015 | - | 1209017..1209187 (-) | 171 | WP_164972002.1 | hypothetical protein | - |
| AYM92_RS06360 (AYM92_06175) | - | 1209188..1210510 (-) | 1323 | WP_030127431.1 | SNF2-related protein | - |
| AYM92_RS06365 (AYM92_06180) | - | 1210507..1210782 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| AYM92_RS06370 (AYM92_06185) | - | 1211168..1213552 (-) | 2385 | WP_032463709.1 | phage/plasmid primase, P4 family | - |
| AYM92_RS06375 (AYM92_06190) | - | 1213557..1215479 (-) | 1923 | WP_030127429.1 | DNA polymerase | - |
| AYM92_RS06380 (AYM92_06195) | - | 1215522..1216085 (-) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| AYM92_RS06385 (AYM92_06200) | - | 1216094..1217251 (-) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| AYM92_RS06390 (AYM92_06205) | - | 1217251..1217550 (-) | 300 | WP_030127427.1 | hypothetical protein | - |
| AYM92_RS06395 (AYM92_06210) | - | 1217638..1217841 (-) | 204 | WP_030127426.1 | hypothetical protein | - |
| AYM92_RS10020 | - | 1217838..1217990 (-) | 153 | WP_017647437.1 | hypothetical protein | - |
| AYM92_RS06400 (AYM92_06215) | - | 1217987..1218373 (-) | 387 | WP_030127425.1 | hypothetical protein | - |
| AYM92_RS06405 (AYM92_06220) | - | 1218370..1218573 (-) | 204 | WP_030127424.1 | hypothetical protein | - |
| AYM92_RS06410 | - | 1218566..1218736 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| AYM92_RS06415 (AYM92_06225) | - | 1218738..1219049 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| AYM92_RS06420 (AYM92_06230) | - | 1219127..1219312 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| AYM92_RS06425 (AYM92_06235) | - | 1219479..1219718 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| AYM92_RS06430 (AYM92_06240) | - | 1219868..1220077 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| AYM92_RS06440 (AYM92_06250) | - | 1220323..1220529 (-) | 207 | WP_001157159.1 | helix-turn-helix domain-containing protein | - |
| AYM92_RS06445 (AYM92_06255) | - | 1220603..1221085 (+) | 483 | WP_021340824.1 | hypothetical protein | - |
| AYM92_RS10025 | - | 1221082..1221228 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| AYM92_RS06450 (AYM92_06260) | - | 1221283..1221882 (+) | 600 | WP_030127422.1 | hypothetical protein | - |
| AYM92_RS06455 | - | 1221913..1222071 (-) | 159 | WP_076636802.1 | hypothetical protein | - |
| AYM92_RS06460 (AYM92_06265) | - | 1222461..1223219 (+) | 759 | WP_030127421.1 | XRE family transcriptional regulator | - |
| AYM92_RS06465 (AYM92_06270) | - | 1223254..1223934 (+) | 681 | WP_030127420.1 | hypothetical protein | - |
| AYM92_RS06470 (AYM92_06275) | - | 1224071..1225213 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| AYM92_RS06475 (AYM92_06280) | - | 1225303..1225578 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| AYM92_RS06480 (AYM92_06285) | - | 1225677..1226264 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| AYM92_RS06485 (AYM92_06290) | - | 1226242..1227084 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6949.84 Da Isoelectric Point: 4.0606
>NTDB_id=172410 AYM92_RS06185 WP_032463717.1 1182811..1182993(-) (prx) [Streptococcus pyogenes strain STAB14018]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=172410 AYM92_RS06185 WP_032463717.1 1182811..1182993(-) (prx) [Streptococcus pyogenes strain STAB14018]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
96.667 |
0.967 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |