Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | AV644_RS03390 | Genome accession | NZ_CP013908 |
| Coordinates | 596359..596547 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain GBS-M002 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 587612..596317 | 596359..596547 | flank | 42 |
| IS/Tn | 595313..595924 | 596359..596547 | flank | 435 |
Gene organization within MGE regions
Location: 587612..596547
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AV644_RS03350 | - | 588991..589152 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| AV644_RS03355 (AV644_03235) | - | 589894..591171 (+) | 1278 | WP_000594367.1 | ABC transporter permease | - |
| AV644_RS03360 (AV644_03240) | - | 591181..591837 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| AV644_RS03365 (AV644_03245) | - | 591837..593213 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| AV644_RS03370 (AV644_03250) | - | 593310..593963 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| AV644_RS03375 (AV644_03255) | - | 593960..595261 (+) | 1302 | WP_000734168.1 | sensor histidine kinase | - |
| AV644_RS03380 (AV644_03260) | - | 595313..595960 (-) | 648 | Protein_566 | IS3 family transposase | - |
| AV644_RS03385 (AV644_03265) | - | 596138..596317 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| AV644_RS03390 (AV644_03270) | prx | 596359..596547 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=165929 AV644_RS03390 WP_000027835.1 596359..596547(+) (prx) [Streptococcus agalactiae strain GBS-M002]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=165929 AV644_RS03390 WP_000027835.1 596359..596547(+) (prx) [Streptococcus agalactiae strain GBS-M002]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |