Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | AUQ45_RS06520 | Genome accession | NZ_CP013672 |
| Coordinates | 1290401..1290583 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain AP53 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1290401..1331613 | 1290401..1290583 | within | 0 |
Gene organization within MGE regions
Location: 1290401..1331613
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUQ45_RS06520 (AUQ45_1307) | prx | 1290401..1290583 (-) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| AUQ45_RS06525 (AUQ45_1308) | sda3 | 1290821..1291621 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| AUQ45_RS06530 (AUQ45_1309) | - | 1291893..1292327 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| AUQ45_RS06535 (AUQ45_1310) | - | 1292377..1293243 (-) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| AUQ45_RS06540 (AUQ45_1311) | - | 1293231..1293755 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| AUQ45_RS06545 (AUQ45_1312) | - | 1293895..1295100 (-) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| AUQ45_RS10280 | - | 1295088..1295210 (-) | 123 | WP_029713948.1 | hypothetical protein | - |
| AUQ45_RS06550 (AUQ45_1313) | - | 1295212..1295667 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| AUQ45_RS06555 (AUQ45_1314) | - | 1295677..1296309 (-) | 633 | WP_011888699.1 | hypothetical protein | - |
| AUQ45_RS06560 (AUQ45_1315) | - | 1296312..1296743 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| AUQ45_RS06565 (AUQ45_1316) | - | 1296755..1298641 (-) | 1887 | WP_014635603.1 | gp58-like family protein | - |
| AUQ45_RS06570 (AUQ45_1317) | - | 1298654..1299664 (-) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| AUQ45_RS06575 (AUQ45_1318) | - | 1299661..1301805 (-) | 2145 | WP_014635605.1 | phage tail spike protein | - |
| AUQ45_RS06580 (AUQ45_1319) | - | 1301802..1302518 (-) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| AUQ45_RS06585 (AUQ45_1320) | - | 1302515..1305775 (-) | 3261 | WP_014635606.1 | tape measure protein | - |
| AUQ45_RS06590 (AUQ45_1321) | - | 1305765..1306346 (-) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| AUQ45_RS06595 (AUQ45_1322) | - | 1306350..1306784 (-) | 435 | WP_011888695.1 | hypothetical protein | - |
| AUQ45_RS06600 (AUQ45_1323) | - | 1306828..1307289 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| AUQ45_RS06605 (AUQ45_1324) | - | 1307289..1307687 (-) | 399 | WP_011888694.1 | minor capsid protein | - |
| AUQ45_RS06610 (AUQ45_1325) | - | 1307684..1308040 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| AUQ45_RS06615 (AUQ45_1326) | - | 1308040..1308372 (-) | 333 | WP_011888693.1 | minor capsid protein | - |
| AUQ45_RS06620 (AUQ45_1327) | - | 1308362..1308778 (-) | 417 | WP_011888692.1 | hypothetical protein | - |
| AUQ45_RS06625 (AUQ45_1328) | - | 1308832..1309650 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| AUQ45_RS06630 (AUQ45_1329) | - | 1309654..1310268 (-) | 615 | WP_011888690.1 | hypothetical protein | - |
| AUQ45_RS06635 (AUQ45_1330) | - | 1310394..1310660 (-) | 267 | WP_011888689.1 | hypothetical protein | - |
| AUQ45_RS06640 (AUQ45_1331) | - | 1310747..1310974 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| AUQ45_RS06645 (AUQ45_1332) | - | 1310974..1312467 (-) | 1494 | WP_014635607.1 | phage minor capsid protein | - |
| AUQ45_RS06650 (AUQ45_1333) | - | 1312472..1313974 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| AUQ45_RS06655 (AUQ45_1334) | - | 1313988..1315279 (-) | 1292 | Protein_1295 | PBSX family phage terminase large subunit | - |
| AUQ45_RS06660 (AUQ45_1335) | - | 1315282..1315758 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| AUQ45_RS06665 (AUQ45_1337) | - | 1316101..1317267 (-) | 1167 | Protein_1297 | DNA modification methylase | - |
| AUQ45_RS06670 (AUQ45_1338) | - | 1317901..1318335 (-) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AUQ45_RS10015 | - | 1318619..1318789 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| AUQ45_RS06675 (AUQ45_1340) | - | 1318786..1319265 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| AUQ45_RS06680 (AUQ45_1341) | - | 1319270..1319902 (-) | 633 | WP_014635608.1 | N-6 DNA methylase | - |
| AUQ45_RS06685 | - | 1319904..1320188 (-) | 285 | WP_011284869.1 | hypothetical protein | - |
| AUQ45_RS10020 (AUQ45_1342) | - | 1320185..1320355 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| AUQ45_RS06690 (AUQ45_1343) | - | 1320352..1320588 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| AUQ45_RS10315 | - | 1320588..1320833 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| AUQ45_RS06700 (AUQ45_1345) | - | 1320830..1321186 (-) | 357 | WP_041174291.1 | hypothetical protein | - |
| AUQ45_RS06705 (AUQ45_1346) | - | 1321183..1321623 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AUQ45_RS06710 | - | 1321623..1321826 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| AUQ45_RS06715 (AUQ45_1347) | ssb | 1321832..1322257 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| AUQ45_RS06720 (AUQ45_1348) | - | 1322250..1322924 (-) | 675 | WP_014635611.1 | ERF family protein | - |
| AUQ45_RS06725 (AUQ45_1349) | - | 1322925..1323407 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| AUQ45_RS06730 (AUQ45_1350) | - | 1323429..1323683 (-) | 255 | WP_063265964.1 | hypothetical protein | - |
| AUQ45_RS06735 (AUQ45_1351) | - | 1323664..1323954 (-) | 291 | WP_014635612.1 | hypothetical protein | - |
| AUQ45_RS06740 (AUQ45_1353) | - | 1324158..1324940 (-) | 783 | WP_011888684.1 | ATP-binding protein | - |
| AUQ45_RS06745 (AUQ45_1354) | - | 1324927..1325688 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| AUQ45_RS10025 (AUQ45_1355) | - | 1325782..1325919 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| AUQ45_RS06750 (AUQ45_1356) | - | 1325950..1326201 (-) | 252 | WP_011888682.1 | AlpA family transcriptional regulator | - |
| AUQ45_RS06755 (AUQ45_1357) | - | 1326272..1326457 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| AUQ45_RS06760 (AUQ45_1358) | - | 1326624..1326863 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| AUQ45_RS06765 (AUQ45_1359) | - | 1326961..1327680 (-) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| AUQ45_RS06770 (AUQ45_1360) | - | 1327708..1327920 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| AUQ45_RS06775 (AUQ45_1361) | - | 1328118..1328459 (+) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| AUQ45_RS06780 (AUQ45_1362) | - | 1328443..1328829 (+) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AUQ45_RS06785 (AUQ45_1363) | - | 1328844..1330265 (+) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| AUQ45_RS06790 (AUQ45_1364) | - | 1330447..1331613 (+) | 1167 | WP_011018152.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=163802 AUQ45_RS06520 WP_011184907.1 1290401..1290583(-) (prx) [Streptococcus pyogenes strain AP53]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=163802 AUQ45_RS06520 WP_011184907.1 1290401..1290583(-) (prx) [Streptococcus pyogenes strain AP53]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |