Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | AUQ45_RS05890 | Genome accession | NZ_CP013672 |
| Coordinates | 1164823..1165005 (-) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain AP53 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1164823..1192637 | 1164823..1165005 | within | 0 |
Gene organization within MGE regions
Location: 1164823..1192637
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUQ45_RS05890 (AUQ45_1178) | prx | 1164823..1165005 (-) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
| AUQ45_RS05895 (AUQ45_1179) | mf2 | 1165245..1166003 (+) | 759 | WP_014635573.1 | DNase Mf2 | - |
| AUQ45_RS05900 (AUQ45_1180) | speC | 1166114..1166821 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| AUQ45_RS05905 (AUQ45_1181) | - | 1166890..1168107 (-) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| AUQ45_RS05910 | - | 1168226..1168453 (-) | 228 | WP_003058873.1 | phage holin | - |
| AUQ45_RS05915 | - | 1168450..1168722 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| AUQ45_RS05920 (AUQ45_1184) | - | 1168734..1169366 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| AUQ45_RS05925 (AUQ45_1185) | - | 1169369..1169797 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| AUQ45_RS05930 (AUQ45_1186) | - | 1169806..1171587 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| AUQ45_RS05935 (AUQ45_1187) | hylP | 1171602..1172717 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| AUQ45_RS05940 (AUQ45_1188) | - | 1172714..1174690 (-) | 1977 | WP_028797149.1 | phage tail spike protein | - |
| AUQ45_RS05945 (AUQ45_1189) | - | 1174672..1175367 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| AUQ45_RS05950 (AUQ45_1190) | - | 1175364..1177721 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| AUQ45_RS05955 (AUQ45_1191) | - | 1177721..1178092 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| AUQ45_RS05960 (AUQ45_1192) | - | 1178107..1178370 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| AUQ45_RS05965 (AUQ45_1193) | - | 1178381..1178959 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| AUQ45_RS05970 (AUQ45_1194) | - | 1178971..1179306 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| AUQ45_RS05975 (AUQ45_1195) | - | 1179551..1179802 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| AUQ45_RS10005 (AUQ45_1196) | - | 1179799..1179954 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| AUQ45_RS05980 (AUQ45_1197) | - | 1179951..1180268 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| AUQ45_RS05985 (AUQ45_1198) | - | 1180304..1180816 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| AUQ45_RS05990 (AUQ45_1199) | - | 1180813..1181145 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| AUQ45_RS05995 (AUQ45_1200) | - | 1181156..1182502 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| AUQ45_RS06000 (AUQ45_1201) | - | 1182499..1182894 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| AUQ45_RS06005 (AUQ45_1202) | - | 1183259..1184056 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| AUQ45_RS06010 (AUQ45_1203) | - | 1184049..1184249 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| AUQ45_RS06015 (AUQ45_1204) | - | 1184246..1185172 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| AUQ45_RS06020 (AUQ45_1205) | - | 1185175..1185504 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| AUQ45_RS06025 (AUQ45_1206) | - | 1185560..1185766 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| AUQ45_RS10010 (AUQ45_1207) | - | 1185775..1185915 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| AUQ45_RS06030 (AUQ45_1208) | - | 1185912..1186145 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| AUQ45_RS06035 (AUQ45_1209) | - | 1186126..1186512 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| AUQ45_RS10180 | - | 1186653..1186922 (-) | 270 | WP_011106700.1 | replication protein | - |
| AUQ45_RS06045 (AUQ45_1210) | - | 1187016..1187201 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| AUQ45_RS06050 (AUQ45_1211) | - | 1187203..1187514 (-) | 312 | WP_010922478.1 | excisionase | - |
| AUQ45_RS06055 (AUQ45_1212) | - | 1187784..1187996 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| AUQ45_RS06060 (AUQ45_1213) | - | 1188198..1188953 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| AUQ45_RS06065 (AUQ45_1214) | - | 1188965..1189483 (+) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| AUQ45_RS06070 (AUQ45_1215) | - | 1189607..1190749 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| AUQ45_RS06075 (AUQ45_1216) | - | 1190838..1191113 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| AUQ45_RS06080 (AUQ45_1217) | - | 1191212..1191799 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| AUQ45_RS06085 (AUQ45_1218) | - | 1191777..1192619 (-) | 843 | WP_014635578.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=163799 AUQ45_RS05890 WP_014635572.1 1164823..1165005(-) (prx) [Streptococcus pyogenes strain AP53]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=163799 AUQ45_RS05890 WP_014635572.1 1164823..1165005(-) (prx) [Streptococcus pyogenes strain AP53]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |