Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | AUQ45_RS05080 | Genome accession | NZ_CP013672 |
| Coordinates | 1004126..1004347 (-) | Length | 73 a.a. |
| NCBI ID | WP_011184577.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain AP53 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 996570..1046568 | 1004126..1004347 | within | 0 |
Gene organization within MGE regions
Location: 996570..1046568
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUQ45_RS05045 (AUQ45_0994) | pfkA | 996570..997583 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| AUQ45_RS05050 (AUQ45_0995) | - | 997663..1000773 (-) | 3111 | WP_002984441.1 | DNA polymerase III subunit alpha | - |
| AUQ45_RS05055 (AUQ45_0996) | - | 1000958..1001329 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| AUQ45_RS05060 (AUQ45_0997) | - | 1001329..1002027 (+) | 699 | WP_002992425.1 | ABC transporter ATP-binding protein | - |
| AUQ45_RS05065 (AUQ45_0998) | - | 1002037..1002822 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| AUQ45_RS05070 (AUQ45_0999) | - | 1002953..1003567 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| AUQ45_RS05080 (AUQ45_1000) | prx | 1004126..1004347 (-) | 222 | WP_011184577.1 | hypothetical protein | Regulator |
| AUQ45_RS05090 (AUQ45_1002) | - | 1004693..1005268 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| AUQ45_RS05095 (AUQ45_1003) | spek | 1005744..1006523 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| AUQ45_RS05100 (AUQ45_1004) | - | 1007390..1008031 (-) | 642 | Protein_975 | CHAP domain-containing protein | - |
| AUQ45_RS05105 (AUQ45_1005) | - | 1008144..1008836 (-) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| AUQ45_RS05110 (AUQ45_1006) | - | 1009072..1009626 (-) | 555 | Protein_977 | glycoside hydrolase family 73 protein | - |
| AUQ45_RS05115 (AUQ45_1007) | - | 1009738..1010193 (-) | 456 | WP_002988455.1 | phage holin family protein | - |
| AUQ45_RS05120 (AUQ45_1008) | - | 1010209..1010814 (-) | 606 | WP_011184581.1 | DUF1366 domain-containing protein | - |
| AUQ45_RS05125 (AUQ45_1009) | - | 1010817..1011245 (-) | 429 | WP_011184582.1 | DUF1617 family protein | - |
| AUQ45_RS05130 (AUQ45_1010) | - | 1011257..1013164 (-) | 1908 | WP_063265949.1 | gp58-like family protein | - |
| AUQ45_RS05135 (AUQ45_1011) | - | 1013174..1014181 (-) | 1008 | WP_063265950.1 | hyaluronoglucosaminidase | - |
| AUQ45_RS05140 (AUQ45_1012) | - | 1014178..1016322 (-) | 2145 | WP_063265951.1 | phage tail spike protein | - |
| AUQ45_RS05145 (AUQ45_1013) | - | 1016319..1017026 (-) | 708 | WP_011184586.1 | distal tail protein Dit | - |
| AUQ45_RS05150 (AUQ45_1014) | - | 1017026..1020949 (-) | 3924 | WP_063265952.1 | phage tail tape measure protein | - |
| AUQ45_RS09970 (AUQ45_1015) | - | 1020962..1021129 (-) | 168 | WP_014411856.1 | hypothetical protein | - |
| AUQ45_RS05155 (AUQ45_1016) | gpG | 1021159..1021485 (-) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| AUQ45_RS05160 (AUQ45_1017) | - | 1021538..1022146 (-) | 609 | WP_023078109.1 | major tail protein | - |
| AUQ45_RS05165 (AUQ45_1018) | - | 1022163..1022588 (-) | 426 | WP_011184592.1 | hypothetical protein | - |
| AUQ45_RS05170 (AUQ45_1019) | - | 1022585..1022962 (-) | 378 | WP_011184593.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AUQ45_RS05175 (AUQ45_1020) | - | 1022959..1023306 (-) | 348 | WP_011184594.1 | phage head closure protein | - |
| AUQ45_RS05180 (AUQ45_1021) | - | 1023303..1023605 (-) | 303 | WP_011184595.1 | head-tail connector protein | - |
| AUQ45_RS10270 (AUQ45_1022) | - | 1023608..1023736 (-) | 129 | WP_011184596.1 | hypothetical protein | - |
| AUQ45_RS05185 (AUQ45_1023) | - | 1023750..1024934 (-) | 1185 | WP_063265953.1 | phage major capsid protein | - |
| AUQ45_RS05190 (AUQ45_1024) | - | 1024960..1025625 (-) | 666 | WP_011184598.1 | head maturation protease, ClpP-related | - |
| AUQ45_RS05195 (AUQ45_1025) | - | 1025603..1026823 (-) | 1221 | WP_011184599.1 | phage portal protein | - |
| AUQ45_RS05200 (AUQ45_1026) | - | 1026857..1027081 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| AUQ45_RS09975 (AUQ45_1027) | - | 1027074..1027244 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| AUQ45_RS05205 (AUQ45_1028) | - | 1027241..1028995 (-) | 1755 | WP_063265954.1 | terminase large subunit | - |
| AUQ45_RS05210 (AUQ45_1029) | - | 1029010..1029477 (-) | 468 | WP_011184601.1 | phage terminase small subunit P27 family | - |
| AUQ45_RS05215 (AUQ45_1030) | - | 1029649..1029990 (-) | 342 | WP_021340284.1 | HNH endonuclease | - |
| AUQ45_RS05220 (AUQ45_1031) | - | 1030294..1030728 (-) | 435 | WP_010922071.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AUQ45_RS05230 (AUQ45_1032) | - | 1030964..1031149 (-) | 186 | WP_011184603.1 | hypothetical protein | - |
| AUQ45_RS05235 (AUQ45_1033) | - | 1031174..1031401 (-) | 228 | WP_021340166.1 | hypothetical protein | - |
| AUQ45_RS05240 (AUQ45_1034) | - | 1031405..1031890 (-) | 486 | WP_012560962.1 | class I SAM-dependent methyltransferase | - |
| AUQ45_RS05245 | - | 1031894..1032178 (-) | 285 | WP_011017570.1 | hypothetical protein | - |
| AUQ45_RS05250 (AUQ45_1035) | - | 1032175..1032588 (-) | 414 | WP_021340162.1 | YopX family protein | - |
| AUQ45_RS05255 (AUQ45_1036) | - | 1032585..1032869 (-) | 285 | WP_021340156.1 | DUF3310 domain-containing protein | - |
| AUQ45_RS10305 | - | 1032863..1033114 (-) | 252 | WP_042765216.1 | hypothetical protein | - |
| AUQ45_RS05265 (AUQ45_1037) | - | 1033111..1033467 (-) | 357 | WP_063265955.1 | hypothetical protein | - |
| AUQ45_RS05270 (AUQ45_1038) | - | 1033838..1035208 (-) | 1371 | WP_021340154.1 | virulence-associated E family protein | - |
| AUQ45_RS05275 (AUQ45_1039) | - | 1035205..1036002 (-) | 798 | WP_027968867.1 | bifunctional DNA primase/polymerase | - |
| AUQ45_RS05280 (AUQ45_1040) | - | 1036019..1036555 (-) | 537 | WP_021340159.1 | DUF669 domain-containing protein | - |
| AUQ45_RS05285 (AUQ45_1041) | - | 1036575..1037345 (-) | 771 | WP_021340168.1 | AAA family ATPase | - |
| AUQ45_RS05290 (AUQ45_1042) | - | 1037346..1038542 (-) | 1197 | WP_021340158.1 | DEAD/DEAH box helicase family protein | - |
| AUQ45_RS05295 (AUQ45_1043) | - | 1038502..1038969 (-) | 468 | WP_021340160.1 | hypothetical protein | - |
| AUQ45_RS05300 (AUQ45_1044) | - | 1038966..1039250 (-) | 285 | WP_021340157.1 | hypothetical protein | - |
| AUQ45_RS05305 (AUQ45_1045) | - | 1039247..1039441 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| AUQ45_RS05310 (AUQ45_1046) | - | 1039441..1039770 (-) | 330 | WP_002984312.1 | hypothetical protein | - |
| AUQ45_RS09980 (AUQ45_1048) | - | 1039851..1039988 (-) | 138 | WP_080464590.1 | hypothetical protein | - |
| AUQ45_RS05315 (AUQ45_1049) | - | 1039985..1040281 (-) | 297 | WP_011184605.1 | MerR family transcriptional regulator | - |
| AUQ45_RS05320 (AUQ45_1050) | - | 1040358..1040534 (-) | 177 | WP_011184606.1 | helix-turn-helix domain-containing protein | - |
| AUQ45_RS05325 (AUQ45_1051) | - | 1040677..1040898 (+) | 222 | WP_002992762.1 | hypothetical protein | - |
| AUQ45_RS05330 (AUQ45_1052) | - | 1040856..1041197 (-) | 342 | WP_011184607.1 | hypothetical protein | - |
| AUQ45_RS05335 (AUQ45_1053) | - | 1041364..1041609 (-) | 246 | WP_002984287.1 | hypothetical protein | - |
| AUQ45_RS05340 (AUQ45_1054) | - | 1041643..1041861 (-) | 219 | WP_063265956.1 | helix-turn-helix transcriptional regulator | - |
| AUQ45_RS05345 (AUQ45_1055) | - | 1041959..1042642 (+) | 684 | WP_011017887.1 | DUF4145 domain-containing protein | - |
| AUQ45_RS09985 (AUQ45_1057) | - | 1042769..1042927 (-) | 159 | WP_011184610.1 | hypothetical protein | - |
| AUQ45_RS09990 (AUQ45_1058) | - | 1042986..1043153 (+) | 168 | WP_021340161.1 | hypothetical protein | - |
| AUQ45_RS05350 (AUQ45_1059) | - | 1043274..1044062 (+) | 789 | WP_011184611.1 | S24 family peptidase | - |
| AUQ45_RS05355 | - | 1044072..1044377 (+) | 306 | WP_011106738.1 | membrane protein | - |
| AUQ45_RS05360 (AUQ45_1061) | - | 1044497..1045585 (+) | 1089 | WP_011017891.1 | site-specific integrase | - |
| AUQ45_RS05365 (AUQ45_1062) | - | 1045948..1046568 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 73 a.a. Molecular weight: 8688.99 Da Isoelectric Point: 4.3322
>NTDB_id=163796 AUQ45_RS05080 WP_011184577.1 1004126..1004347(-) (prx) [Streptococcus pyogenes strain AP53]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTEEKVEEVMVELDYIIMKKTLSRQKNN
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTEEKVEEVMVELDYIIMKKTLSRQKNN
Nucleotide
Download Length: 222 bp
>NTDB_id=163796 AUQ45_RS05080 WP_011184577.1 1004126..1004347(-) (prx) [Streptococcus pyogenes strain AP53]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCATAATGAAGAAAACTTTGAGTAGACAGAAAAATAATTGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCATAATGAAGAAAACTTTGAGTAGACAGAAAAATAATTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.803 |
83.562 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
84.483 |
79.452 |
0.671 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
80.822 |
0.658 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
79.452 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
80.822 |
0.616 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
56.164 |
0.507 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
57.534 |
0.452 |