Detailed information NTG0160956

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: APQ13_RS00260
• Genome accession: NZ_CP013237
• Coordinates: 46776..47366 (+)
• Length: 196 a.a.
• NCBI ID: WP_002264033.1
• Uniprot ID: -
• Organism: Streptococcus mutans strain NG8 isolate Dental Plaque
• Function: degradation of ComX; require for competence development (at the early growth phase); repress competence development (at the mid-logarithmic growth phase) (predicted from homology) Competence regulation

Genomic Context

Location: 41776..52366

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
APQ13_RS00245 (APQ13_00245)	-	43228..44322 (+)	1095	WP_002273608.1	cystathionine gamma-synthase	-
APQ13_RS00250 (APQ13_00250)	-	44337..45500 (+)	1164	WP_002272971.1	MalY/PatB family protein	-
APQ13_RS00255 (APQ13_00255)	upp	45813..46442 (+)	630	WP_002266834.1	uracil phosphoribosyltransferase	-
APQ13_RS00260 (APQ13_00260)	clpP	46776..47366 (+)	591	WP_002264033.1	ATP-dependent Clp protease proteolytic subunit ClpP	Regulator
APQ13_RS00265 (APQ13_00265)	-	47489..47929 (+)	441	WP_002264032.1	YlbF family regulator	-
APQ13_RS00270 (APQ13_00270)	-	47936..48184 (+)	249	WP_002262674.1	YlbG family protein	-
APQ13_RS00275 (APQ13_00275)	-	48292..49464 (+)	1173	WP_002262675.1	ABC transporter substrate-binding protein	-
APQ13_RS00280 (APQ13_00280)	-	49548..50417 (+)	870	WP_061046365.1	branched-chain amino acid ABC transporter permease	-
APQ13_RS00285 (APQ13_00285)	-	50421..51377 (+)	957	WP_002266832.1	branched-chain amino acid ABC transporter permease	-
APQ13_RS00290 (APQ13_00290)	-	51377..52141 (+)	765	WP_002262678.1	ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 196 a.a.
• Molecular weight: 21655.92 Da
• Isoelectric Point: 5.3292

>NTDB_id=160956 APQ13_RS00260 WP_002264033.1 46776..47366(+) (clpP) [Streptococcus mutans strain NG8 isolate Dental Plaque]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDNTKDIYLYINSPGGSVSAGLAIVDTMN
FIKSDVQTIVMGIAASMGTIIASSGAKGKRFMLPNAEYLIHQPMGGTGGGTQQSDMAIAAEQLLKTRKKLEKILSDNSGK
TVKQIHKDAERDYWMDAKETLKYGFIDEIMENNELK

Nucleotide

• Length: 591 bp

>NTDB_id=160956 APQ13_RS00260 WP_002264033.1 46776..47366(+) (clpP) [Streptococcus mutans strain NG8 isolate Dental Plaque]
ATGATTCCTGTAGTTATTGAACAAACGAGCCGTGGTGAACGCTCTTATGATATTTATTCACGTCTATTAAAAGATCGTAT
TATTATGTTGACTGGTCCTGTTGAAGACAATATGGCAAATTCCATTATTGCTCAGTTACTGTTTCTTGATGCACAAGATA
ATACCAAAGACATTTATCTTTATATTAATTCACCGGGTGGTTCTGTTTCAGCTGGTCTTGCTATTGTTGATACGATGAAC
TTTATTAAGTCTGATGTTCAAACGATTGTTATGGGTATTGCTGCTTCCATGGGAACAATCATCGCTTCTAGCGGTGCCAA
AGGAAAACGTTTTATGTTACCAAATGCAGAATATCTTATCCATCAGCCAATGGGCGGTACAGGCGGTGGCACACAGCAGT
CTGATATGGCTATTGCTGCCGAACAATTGCTTAAAACACGCAAAAAATTAGAAAAGATTCTATCGGATAATTCTGGAAAA
ACAGTAAAACAAATTCATAAGGATGCTGAACGTGATTATTGGATGGATGCTAAGGAAACATTAAAGTATGGCTTCATCGA
TGAAATCATGGAAAATAATGAATTAAAATAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (11-192)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Streptococcus mutans UA159	99.49	100	0.995
clpP	Streptococcus pyogenes JRS4	90.306	100	0.903
clpP	Streptococcus pyogenes MGAS315	90.306	100	0.903
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	87.755	100	0.878
clpP	Streptococcus thermophilus LMD-9	87.245	100	0.872
clpP	Lactococcus lactis subsp. cremoris KW2	87.245	100	0.872
clpP	Streptococcus thermophilus LMG 18311	87.245	100	0.872
clpP	Streptococcus pneumoniae Rx1	86.154	99.49	0.857
clpP	Streptococcus pneumoniae D39	86.154	99.49	0.857
clpP	Streptococcus pneumoniae R6	86.154	99.49	0.857
clpP	Streptococcus pneumoniae TIGR4	86.154	99.49	0.857
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	57.513	98.469	0.566
clpP	Bacillus subtilis subsp. subtilis str. 168	56.122	100	0.561